Recombinant Teredinibacter turnerae ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes. We will accommodate your request as best as possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be selected during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize its inclusion.
Synonyms
atpB; TERTU_4722; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Teredinibacter turnerae (strain ATCC 39867 / T7901)
Target Names
atpB
Target Protein Sequence
MASSETLTITDYITHHLQNMTYGKLPAGYARHHADGEVHVLEHDTWTMAHTAEEAAAMGF NAVHVDTLGWGIFLALVVGFFMRRVAVKATTDTPRGMASFIEFLVEGINGVVKDVFHHKN RLVAPMAITVFSWVFMMNLMDLIPVDWLPMAAQIVSGNEHLFFKVVPTTDPNATLGMAVT VFILMLFFSVQQKGLWGFIKELTCHPFFAPRKFWYFNLILIPFNFILETVALIAKPISLG LRLFGNLYAGEMIFILIATLFSVGLLFGFLGGILQFGWAVLHILVILIQAFVFMVLTTVY MAMAHDRHDEH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Teredinibacter turnerae and why is it significant for research?

Teredinibacter turnerae is a marine gamma proteobacterium that functions as an intracellular endosymbiont in the gills of wood-boring marine bivalves of the family Teredinidae, commonly known as shipworms. This bacterium is particularly notable because it is the sole cultivated member of an endosymbiotic consortium that provides the host with essential enzymes for wood digestion and nitrogen supplementation .

T. turnerae possesses remarkable capabilities that have attracted scientific interest. It is one of the few aerobic bacteria known to grow with cellulose as its sole carbon source and dinitrogen as its sole nitrogen source. Its genome encodes over 100 enzymes involved in complex polysaccharide degradation, with a specialization for breaking down terrestrial woody plant materials including cellulose, xylan, mannan, galactorhamnan, and pectin .

Unlike many obligate intracellular endosymbionts, T. turnerae lacks typical genomic features associated with obligate intracellular existence such as reduced genome size or decreased G+C content. Instead, it displays adaptations more common to free-living bacteria, suggesting it is a facultative intracellular endosymbiont whose ecological niche may include free-living states .

What is ATP synthase subunit a (atpB) and what is its role in Teredinibacter turnerae?

ATP synthase subunit a, encoded by the atpB gene, is a critical component of the F0 sector of ATP synthase, a multisubunit enzyme complex responsible for ATP production during cellular respiration. In T. turnerae, as in other bacteria, this membrane-embedded protein forms part of the proton channel that enables proton translocation across the membrane, which drives the synthesis of ATP .

The atpB protein in T. turnerae consists of 311 amino acids and functions within the ATP synthase complex to facilitate the conversion of electrochemical potential energy, stored as a proton gradient across the membrane, into chemical energy in the form of ATP. This process is essential for the organism's energy metabolism and survival, particularly in the context of its specialized ecological niche as an endosymbiont with cellulolytic capabilities .

What expression systems are suitable for producing recombinant T. turnerae atpB?

Based on available information, recombinant T. turnerae ATP synthase subunit a (atpB) has been successfully expressed in Escherichia coli expression systems. The commercially available recombinant protein consists of the full-length sequence (amino acids 1-311) fused to an N-terminal His tag to facilitate purification .

For optimal expression, researchers might consider:

  • Using specialized E. coli strains designed for membrane protein expression

  • Employing tightly regulated promoters to control expression levels

  • Optimizing growth temperature and induction conditions

  • Testing different fusion tags beyond His-tags (such as MBP or SUMO) if solubility is an issue

What are the optimal storage conditions for recombinant T. turnerae atpB?

The recombinant T. turnerae ATP synthase subunit a protein is typically supplied as a lyophilized powder. For long-term storage, the following conditions are recommended:

  • Store the lyophilized protein at -20°C to -80°C upon receipt

  • Aliquoting is necessary for multiple use to prevent repeated freeze-thaw cycles

  • Once reconstituted, working aliquots can be stored at 4°C for up to one week

  • For longer storage after reconstitution, add glycerol (final concentration 5-50%, with 50% being commonly used) and store at -20°C to -80°C

Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity. The storage buffer typically consists of a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain protein stability during freeze-thaw processes .

How should researchers reconstitute lyophilized recombinant T. turnerae atpB?

For proper reconstitution of lyophilized recombinant T. turnerae atpB protein, researchers should follow these methodological steps:

  • Briefly centrifuge the vial containing the lyophilized protein prior to opening to ensure the material is at the bottom of the vial

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage of the reconstituted protein, add glycerol to a final concentration of 5-50% (typically 50%)

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Verify protein concentration using standard protein determination methods such as Bradford or BCA assay

When working with membrane proteins like atpB, researchers might need to consider the addition of mild detergents during reconstitution to maintain protein solubility and prevent aggregation, although this should be determined empirically for each specific experimental application.

How can researchers investigate the role of T. turnerae atpB in the context of its symbiotic relationship with shipworms?

Investigating the role of atpB in the symbiotic relationship between T. turnerae and shipworms requires a multidisciplinary approach spanning molecular biology, biochemistry, and ecology. Given that T. turnerae provides essential enzymes for wood digestion and nitrogen fixation for its shipworm host, understanding the role of energy metabolism through ATP synthase is crucial.

Methodological approaches might include:

  • Comparative genomics and transcriptomics: Compare atpB expression levels between free-living T. turnerae and those in the symbiotic state within shipworm gills to determine if energy metabolism is regulated differently in these contexts .

  • Localization studies: Use immunofluorescence microscopy with antibodies against recombinant atpB to visualize the distribution of ATP synthase within bacterial cells in the shipworm gill tissue.

  • Functional mutagenesis: Generate atpB mutants with altered activity and examine how these affect the bacterium's ability to provide benefits to the host through cellulose degradation and nitrogen fixation.

  • Metabolic flux analysis: Use isotope labeling to track energy flow in the symbiotic system, focusing on how ATP production by T. turnerae contributes to the host's metabolism.

These approaches would help elucidate how energy production by T. turnerae, mediated by ATP synthase, supports its specialized functions within the symbiotic relationship with shipworms.

How does the structure and function of T. turnerae atpB relate to its adaptation to specialized ecological niches?

T. turnerae has adapted to a unique ecological niche as both an endosymbiont in shipworm gills and potentially as a free-living bacterium. The ATP synthase, including the atpB subunit, plays a crucial role in energy generation that supports the bacterium's specialized functions.

The genome of T. turnerae lacks many features typical of obligate intracellular symbionts (such as reduced genome size or reduced G+C content) and instead displays features common to free-living bacteria . This suggests that ATP production and energy metabolism in T. turnerae may need to be adaptable to different environmental conditions.

The atpB protein's structure and function may reflect adaptations to:

  • Varying oxygen levels: As T. turnerae moves between the microaerophilic environment of shipworm gills and potentially more aerobic free-living conditions, its ATP synthase might have structural adaptations to function optimally under different oxygen tensions.

  • Fluctuating nutrient availability: The bacterium's ability to utilize cellulose as a sole carbon source likely requires significant ATP production to support the energetically demanding process of cellulose degradation .

  • Ion composition differences: The marine environment and host tissues present different ionic conditions, which may be reflected in specific adaptations in the proton channel formed partly by atpB.

Comparative structural analysis of T. turnerae atpB with homologs from related free-living bacteria like Saccharophagus degradans could provide insights into specific adaptations related to its dual lifestyle .

What methodologies are appropriate for studying the enzymatic activity of recombinant T. turnerae atpB?

  • Reconstitution into proteoliposomes: The recombinant atpB protein can be incorporated into artificial lipid vesicles along with other ATP synthase subunits to reconstitute a functional complex. This system can then be used to measure ATP synthesis driven by artificially imposed proton gradients.

  • Proton translocation assays: Using pH-sensitive fluorescent dyes, researchers can monitor proton movement facilitated by atpB when incorporated into membrane systems.

  • Complementation studies: Expressing recombinant T. turnerae atpB in ATP synthase-deficient bacterial strains can help assess functional complementation and enzyme activity in vivo.

  • Site-directed mutagenesis: Strategic mutations can be introduced into conserved residues of the atpB sequence to identify amino acids critical for proton translocation or interaction with other ATP synthase subunits.

  • Inhibitor studies: Using specific ATP synthase inhibitors and measuring their effects on reconstituted systems containing T. turnerae atpB can provide insights into functional mechanisms.

These experimental approaches would typically require the following controls:

  • Empty liposomes without incorporated protein

  • Systems with known functional ATP synthase components

  • Heat-inactivated recombinant atpB protein

  • Systems with well-characterized ATP synthase inhibitors

What techniques are most effective for analyzing protein-protein interactions involving T. turnerae atpB?

As a membrane-integrated component of the ATP synthase complex, atpB participates in multiple protein-protein interactions that are essential for its function. Several complementary techniques can be employed to study these interactions:

  • Co-immunoprecipitation: Using antibodies against recombinant His-tagged atpB to pull down interacting partners from T. turnerae lysates, followed by mass spectrometry identification.

  • Crosslinking studies: Chemical crosslinkers can capture transient interactions between atpB and other ATP synthase subunits, which can then be analyzed by mass spectrometry.

  • Förster Resonance Energy Transfer (FRET): By labeling atpB and potential interaction partners with appropriate fluorophores, FRET can detect close proximity between proteins in membrane environments.

  • Bacterial two-hybrid systems: Modified for membrane proteins, these systems can screen for interactions between atpB and other proteins in a cellular context.

  • Surface Plasmon Resonance (SPR): When combined with appropriate detergent systems, SPR can provide quantitative binding kinetics for interactions involving reconstituted atpB.

For all these approaches, the hydrophobic nature of atpB presents technical challenges that must be addressed through careful optimization of detergents, buffer conditions, and experimental protocols.

How can recombinant T. turnerae atpB be used in comparative studies of ATP synthase evolution?

The ATP synthase complex is highly conserved across all domains of life, yet shows specific adaptations in different organisms. Recombinant T. turnerae atpB can serve as a valuable tool for comparative evolutionary studies through several methodological approaches:

  • Sequence-structure-function analysis: Comparing the sequence of T. turnerae atpB with homologs from free-living bacteria, other endosymbionts, and diverse prokaryotes can identify conserved functional domains versus lineage-specific adaptations.

  • Chimeric protein studies: Creating fusion proteins containing domains from T. turnerae atpB and corresponding regions from other bacterial species can help identify regions responsible for specific functional properties.

  • Ancestral sequence reconstruction: Using T. turnerae atpB in conjunction with sequences from diverse bacteria to computationally reconstruct ancestral sequences and express these as recombinant proteins for functional studies.

  • Horizontal gene transfer analysis: Investigating whether the atpB gene in T. turnerae shows evidence of horizontal acquisition, which might explain adaptations to its specialized lifestyle.

These approaches could reveal how ATP synthase components have evolved in the context of symbiotic relationships and specialized metabolic capabilities like cellulose degradation and nitrogen fixation that characterize T. turnerae .

What analytical techniques are most suitable for assessing the purity and integrity of recombinant T. turnerae atpB?

For rigorous quality control of recombinant T. turnerae atpB preparations, researchers should employ multiple complementary analytical techniques:

  • SDS-PAGE: The primary method for assessing protein purity, with recombinant T. turnerae atpB preparations typically showing >90% purity .

  • Western blotting: Using anti-His antibodies to confirm the identity of the recombinant protein and detect any degradation products.

  • Mass spectrometry: Providing precise molecular weight determination and verification of the amino acid sequence, especially important after reconstitution or storage.

  • Circular dichroism (CD) spectroscopy: Assessing the secondary structure content to confirm proper folding of the recombinant protein.

  • Size-exclusion chromatography: Evaluating the homogeneity of the protein preparation and detecting potential aggregation.

  • Dynamic light scattering: Complementing size-exclusion chromatography to assess protein homogeneity and stability in solution.

For membrane proteins like atpB, additional consideration should be given to:

  • Detergent concentration and micelle formation

  • Lipid content of the preparation

  • Potential co-purifying proteins from the expression host

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.