Recombinant Teredinibacter turnerae Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Enzymatic Role

lspA is the second enzyme in the lipoprotein-processing pathway, cleaving the transmembrane helix signal peptide of lipidated prolipoproteins after lipidation by Lgt. This step is essential for proper lipoprotein maturation, which is critical for bacterial viability, virulence, and stress responses .

Source and Host Systems

Recombinant lspA is expressed in mammalian or microbial systems (e.g., E. coli) and purified to >85% homogeneity (SDS-PAGE) . The protein corresponds to residues 1–168 of T. turnerae lspA (Uniprot: C5BQX3) .

Conformational Dynamics

Molecular dynamics (MD) simulations and electron paramagnetic resonance (EPR) revealed three key states of lspA:

  1. Closed State: Dominant in apo form; PH occludes the active site, protecting it from hydrophobic membrane interactions .

  2. Intermediate State: Stabilized by globomycin binding; inhibits substrate access .

  3. Open State: Observed in MD simulations; allows substrate entry and cleavage .

These dynamic fluctuations explain lspA’s ability to process diverse lipoprotein substrates .

Antibiotic Binding Mechanisms

Globomycin binds via interactions with the catalytic dyad and PH, locking lspA in an inactive conformation. This inhibition prevents signal peptide cleavage, highlighting lspA as a promising antibiotic target .

Teredinibacter turnerae as a Model Organism**

T. turnerae is a symbiont in shipworm gills, contributing cellulose-degrading enzymes. Its genome encodes >100 polysaccharide-degrading enzymes, underscoring its role in wood digestion . lspA’s conservation across bacterial lineages (e.g., E. coli, M. tuberculosis) makes it a universal target .

Applications in Biotechnology and Drug Development

  • Antibiotic Research: lspA’s conserved active site and essentiality in Gram-negative bacteria make it a target for broad-spectrum antibiotics .

  • Structural Biology: Recombinant lspA enables EPR and crystallography studies to probe conformational changes .

  • Diagnostic Tools: Used in ELISA kits for detecting bacterial lipoprotein processing .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; TERTU_1041; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Teredinibacter turnerae (strain ATCC 39867 / T7901)
Target Names
lspA
Target Protein Sequence
MHKLNVLAALKWYGVALLVILLDQITKNVASHMLVLHQPEPITSFFNFTLRHNFGAAFSM FHDAGGWQRWFLALLAAGVSVLLIFWIAKLPKQKWMEALALALVLGGALGNLYDRMLLGY VVDFIVVHYKEHEWPAFNIADSAICIGAALLVWDSLFGTKVAKYGDAK
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Teredinibacter turnerae and why is it significant for enzyme research?

T. turnerae is a marine gamma proteobacterium that exists as an intracellular bacterial symbiont in the gills of wood-eating shipworms . This bacterium has gained significant research attention because it produces cellulolytic enzymes and fixes atmospheric nitrogen that contributes to shipworm metabolism in woody environments where nitrogen is restricted . The genome of T. turnerae contains a treasure chest of potentially useful lignocellulose degrading proteins and various carbohydrate active enzymes including glycoside hydrolases from families 5, 8, and 12, as well as lytic polysaccharide monooxygenases . Additionally, T. turnerae produces bioactive compounds including antibiotics like turnercyclamycins that are bactericidal against challenging Gram-negative pathogens, even those resistant to conventional antibiotics .

What is the role of lipoprotein signal peptidase (lspA) in bacterial systems?

Lipoprotein signal peptidase (lspA) is an essential enzyme in bacterial lipoprotein biosynthesis that cleaves the signal peptide from prolipoproteins after lipid modification. This processing is critical for proper lipoprotein maturation and localization. In bacterial symbionts like T. turnerae, functional lipoproteins are particularly important for:

  • Cell envelope integrity

  • Nutrient acquisition systems (particularly iron uptake via siderophores)

  • Host-microbe interactions

  • Protein secretion mechanisms

The importance of properly processed lipoproteins in T. turnerae is evidenced by the bacterium's complex secretion systems that are likely employed for both symbiotic interactions with its shipworm host and the export of enzymes for lignocellulose degradation .

How does lspA contribute to T. turnerae's symbiotic relationship with shipworms?

LspA likely plays a crucial role in the symbiotic relationship between T. turnerae and shipworms by ensuring proper processing of lipoproteins involved in:

  • Cell surface structures that mediate adherence to host tissues

  • Secretion systems for enzymes that contribute to wood digestion

  • Processing of proteins involved in nitrogen fixation pathways

  • Components of siderophore synthesis and uptake systems, like turnerbactin

T. turnerae engages in a mutually beneficial relationship with its shipworm host, providing cellulolytic enzymes for wood digestion and fixed nitrogen in environments where nitrogen is limited . Proper lipoprotein processing by lspA would be essential for maintaining the cellular machinery required for these symbiotic functions.

What expression systems are optimal for recombinant T. turnerae lspA production?

Based on previous success with other T. turnerae enzymes, the following expression systems are recommended for recombinant lspA production:

Expression SystemAdvantagesConsiderations
E. coli BL21(DE3) with pET vectorsHigh expression levels, controllable inductionMay require optimization to prevent inclusion body formation
E. coli with pelB signal peptidePromotes periplasmic expression for better foldingDemonstrated success with other T. turnerae enzymes
E. coli C43(DE3)Specialized for membrane protein expressionUseful if lspA shows toxicity in standard strains
Cold-adapted expression (16-18°C)Improves folding of complex proteinsRequires longer induction periods

The use of pelB signal peptide has been specifically documented for successful soluble expression of other enzymes from T. turnerae, suggesting this approach may be particularly valuable for lspA expression .

What solubilization and purification strategies are most effective for T. turnerae lspA?

As lspA is a membrane-associated enzyme, specialized purification approaches are necessary:

  • Initial membrane preparation:

    • Mechanical cell disruption (sonication or French press)

    • Differential centrifugation to isolate membrane fractions

    • Selective solubilization using mild detergents

  • Detergent selection for solubilization:

    • DDM (n-Dodecyl β-D-maltoside) - often effective for membrane proteins

    • LDAO (Lauryldimethylamine oxide) - useful for maintaining enzymatic activity

    • Test detergent panels to determine optimal solubilization conditions

  • Purification workflow:

    • IMAC (Immobilized Metal Affinity Chromatography) using His-tagged constructs

    • Ion exchange chromatography for further purification

    • Size exclusion chromatography to remove aggregates and achieve homogeneity

  • Activity preservation:

    • Maintain detergent above CMC (critical micelle concentration) throughout purification

    • Consider adding phospholipids to stabilize the protein

    • Test stabilizing additives like glycerol or specific divalent cations

How can researchers assess the enzymatic activity of recombinant T. turnerae lspA?

Multiple complementary approaches can be employed to assess lspA activity:

  • Fluorogenic peptide substrates:

    • Synthetic peptides mimicking natural prolipoproteins with fluorescent quencher pairs

    • Cleavage results in measurable fluorescence increase

    • Allows for quantitative kinetic measurements

  • Mass spectrometry-based assays:

    • Incubation of recombinant lspA with synthetic or natural prolipoprotein substrates

    • LC-MS/MS analysis to identify cleavage products

    • Provides detailed information about substrate specificity

  • In vivo complementation assays:

    • Use of lspA-deficient bacterial strains

    • Assessment of growth rescue by T. turnerae lspA expression

    • Particularly useful for confirming functional activity

  • Radiolabeled substrate assays:

    • Tritium-labeled prolipoproteins as substrates

    • Analysis of labeled cleavage products

    • Provides highly sensitive detection of enzymatic activity

What structural features distinguish T. turnerae lspA from other bacterial lipoprotein signal peptidases?

While the crystal structure of T. turnerae lspA has not been explicitly reported in the provided search results, comparative analysis with other bacterial lspA enzymes would focus on:

  • Active site architecture:

    • Conservation of catalytic aspartate residues

    • Potential adaptations for functioning in marine/symbiotic environments

    • Substrate-binding pocket variations that might reflect specialized prolipoprotein processing needs

  • Membrane-interaction domains:

    • Hydrophobic transmembrane segments

    • Interfacial residues that might be adapted to T. turnerae's intracellular lifestyle

  • Regulatory elements:

    • Regions that might respond to environmental signals relevant to the symbiotic relationship

    • Potential interaction sites with other components of the lipoprotein processing machinery

Comparative modeling based on known lspA structures would be a valuable approach to predict these structural features pending experimental determination.

How does iron availability affect lspA expression and function in T. turnerae?

Iron regulation is particularly relevant to T. turnerae biology given its production of the siderophore turnerbactin for iron acquisition . For lspA research, consider:

  • Potential regulatory connections:

    • Iron availability may regulate lspA expression if it processes lipoproteins involved in iron acquisition

    • The turnerbactin biosynthetic cluster and related iron uptake mechanisms could be functionally linked to lspA activity

  • Experimental approaches:

    • qRT-PCR to assess lspA transcript levels under iron-limited vs. iron-replete conditions

    • Proteomic analysis to determine if lspA protein abundance changes with iron availability

    • Functional assays to test if lspA activity is modified by iron concentration

  • Related findings:

    • T. turnerae produces turnerbactin required for survival under iron-limiting conditions

    • The Fe(III)-turnerbactin uptake mechanisms involve TonB-dependent outer membrane receptors

    • These systems may require properly processed lipoproteins, pointing to a potential role for lspA

What challenges might researchers encounter when working with recombinant T. turnerae lspA?

Several technical challenges should be anticipated:

  • Membrane protein expression barriers:

    • Toxicity to expression hosts

    • Protein misfolding and inclusion body formation

    • Low yields of active enzyme

  • Enzymatic assay complications:

    • Need for detergent-compatible activity assays

    • Potential inhibition by detergents required for solubilization

    • Limited availability of natural substrates from T. turnerae

  • Biochemical characterization difficulties:

    • Challenging biophysical analyses due to detergent presence

    • Limited structural data for comparative purposes

    • Potential requirement for specific lipid environments for optimal activity

  • Host context dependencies:

    • T. turnerae normally functions within shipworm cells

    • Recombinant systems may lack cofactors or interaction partners present in the native context

How can researchers optimize codon usage for heterologous expression of T. turnerae lspA?

T. turnerae genes may contain rare codons that limit expression in E. coli. Optimization approaches include:

  • Codon optimization strategies:

    • Full gene synthesis with codons optimized for the expression host

    • Use of E. coli Rosetta strains that supply rare tRNAs

    • Targeted modification of only the most problematic rare codons

  • Analysis tools:

    • GenScript Rare Codon Analysis Tool

    • OPTIMIZER web server

    • JCat (Java Codon Adaptation Tool)

  • Additional optimization considerations:

    • Removal of potential internal Shine-Dalgarno sequences

    • Elimination of mRNA secondary structures in the 5' region

    • Introduction of silent mutations to remove repetitive sequences

What substrate specificity assays reveal the most about T. turnerae lspA function?

To comprehensively characterize T. turnerae lspA substrate specificity:

  • Synthetic peptide library screening:

    • Peptides based on predicted T. turnerae prolipoprotein signal sequences

    • Systematic variation of residues around the cleavage site

    • High-throughput fluorogenic assays to determine preference patterns

  • Natural substrate identification:

    • Proteomic analysis of T. turnerae lipoproteome

    • Comparative analysis of processing in wild-type vs. lspA-depleted conditions

    • Mass spectrometry to identify precise cleavage sites

  • Chimeric substrate analysis:

    • Construction of hybrid substrates containing signal sequences from different bacterial species

    • Assessment of processing efficiency to determine recognition requirements

    • Mutation analysis of key residues to define the substrate recognition motif

  • Computational prediction validation:

    • Use bioinformatic tools to predict potential lipoprotein substrates in the T. turnerae genome

    • Experimental validation of selected candidates

    • Development of a T. turnerae-specific lipoprotein prediction algorithm

What approaches can verify the biological relevance of in vitro findings about T. turnerae lspA?

Bridging in vitro biochemistry with biological significance requires:

  • Genetic manipulation approaches:

    • Construction of lspA mutants in T. turnerae (if genetic systems exist)

    • Complementation with wild-type and mutant variants

    • Assessment of phenotypic changes related to symbiosis, enzyme secretion, or growth

  • Heterologous expression studies:

    • Expression of T. turnerae lspA in model bacteria with lspA deletions

    • Functional assessment of complementation

    • Comparison of lipoprotein profiles

  • Co-culture experiments:

    • Establishment of T. turnerae-shipworm cell co-cultures

    • Manipulation of lspA expression or activity

    • Assessment of effects on symbiotic parameters

  • Comparative genomics:

    • Analysis of lspA conservation across T. turnerae strains from different shipworm hosts

    • Correlation of sequence variations with host specificity or ecological niches

    • Identification of selection pressures on the lspA gene

How should researchers address contradictory results in T. turnerae lspA activity assays?

When faced with contradictory findings:

  • Systematic troubleshooting approach:

    • Vary detergent types and concentrations

    • Test different buffer conditions (pH, ionic strength, additives)

    • Assess enzyme stability under assay conditions

    • Evaluate potential inhibitors in reagents or expression system

  • Multiple assay validation:

    • Employ orthogonal activity assays using different detection principles

    • Compare in vitro biochemical assays with in vivo functional tests

    • Use both synthetic and natural substrates when possible

  • Comparative benchmarking:

    • Test characterized lspA enzymes from other bacteria under identical conditions

    • Determine if contradictions are specific to T. turnerae lspA or common to the enzyme class

    • Establish positive and negative controls for each experiment

  • Consider biological context:

    • Evaluate if contradictions might reflect actual biological regulation

    • Test if symbiont-specific factors might be required for proper activity

    • Investigate temperature, salt, or pressure effects relevant to the marine environment

What statistical approaches are appropriate for analyzing variability in recombinant T. turnerae lspA expression and activity?

Rigorous statistical analysis should include:

  • Experimental design considerations:

    • Minimum of three biological replicates for each condition

    • Technical replicates to assess measurement variability

    • Inclusion of appropriate positive and negative controls

  • Data analysis methods:

    • ANOVA for comparing multiple expression conditions

    • Non-parametric tests when normality cannot be assumed

    • Multiple comparison corrections (e.g., Bonferroni, Tukey HSD)

  • Enzyme kinetics analysis:

    • Non-linear regression for determination of Km and Vmax

    • Global fitting approaches for inhibition studies

    • Bootstrap methods to estimate parameter confidence intervals

  • Reporting standards:

    • Clear description of outlier handling

    • Transparent sharing of raw data

    • Appropriate graphical representation with error bars

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.