Recombinant Teredinibacter turnerae Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Functional Role in Membrane Protein Biogenesis

YidC operates as a membrane insertase, facilitating the co-translational integration of membrane proteins either independently or in conjunction with the SecYEG translocon . Key functional insights include:

  • Substrate Specificity: YidC mediates the insertion of energy-transducing respiratory complexes and nitrogenase components, essential for T. turnerae’s symbiotic role in shipworm hosts .

  • Structural Mechanism: Evolutionary co-variation and molecular dynamics simulations reveal that YidC’s hydrophilic cavity interacts with nascent transmembrane domains, enabling lipid-exposed or SecYEG-assisted integration .

  • Conservation: The YidC family is universally conserved across bacteria and eukaryotic organelles, underscoring its fundamental role in membrane biology .

Genomic and Metabolic Context in T. turnerae

The yidC gene (locus tag: TERTU_4739) is part of the T. turnerae T7901 genome, which encodes >100 lignocellulolytic enzymes and nitrogenase . This genomic repertoire supports its symbiotic function in shipworms, where it aids in wood digestion and nitrogen fixation . YidC’s role in integrating iron-rich enzymes (e.g., nitrogenase) aligns with T. turnerae’s high iron demand, partially met via siderophores like turnerbactin .

Research Applications

Recombinant YidC is utilized in diverse experimental systems:

  • Membrane Protein Studies: Reconstituted in proteoliposomes to analyze substrate insertion kinetics and chaperone activity .

  • Structural Biology: Cryo-EM studies of YidC-ribosome complexes elucidate its interaction with nascent chains (e.g., substrate F₀c) .

  • Biotechnology: Optimizing heterologous membrane protein expression in E. coli for industrial enzyme production .

Functional Domains and Catalytic Features

A domain-level breakdown of YidC’s structure is provided below:

DomainFunction
TM1–TM5 CoreForms a hydrophilic cavity for substrate interaction
Cytoplasmic HairpinStabilizes ribosome interactions during co-translational insertion
Conserved Glycine MotifFacilitates conformational flexibility during membrane integration

Challenges and Future Directions

While recombinant YidC is a robust tool for in vitro studies, its in vivo regulation and interaction with auxiliary factors (e.g., SecYEG) remain partially characterized . Future work may explore:

  • Engineering YidC variants for enhanced substrate specificity.

  • High-throughput screening of YidC-dependent membrane protein expression.

  • Comparative studies with eukaryotic homologs (e.g., Oxa1 in mitochondria) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yidC; TERTU_4739; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-560
Protein Length
full length protein
Species
Teredinibacter turnerae (strain ATCC 39867 / T7901)
Target Names
yidC
Target Protein Sequence
MNLLRNALIGGIVLVSFLLIIRWNEFQERKFEETQLQQSSANNSERVAPSIPSEQPQAPN GEEVPDAPASDSKDAVEFTANADNDRQIHISTDTLDLVIDTNGGDIVRLALPQYYAMLHE KDNPFVLLNNNDTSTYIAQSGLVGPNGTDGKNGRPRFSAASSDYTLEPGKDTLVVDLKYQ QESAIITKRFTFHRDSYLIDLEYLIENTGDTNWVGNLYGQIKRDDHNPAQAVGVGMQPFL GAAITTPETNYKKLKFDELAKEKLEVSNTGGWVAMVQHYFMSAWVPDQDKDQKYVLRKSR NANMYFLSFTTLTSTTVAPGTTGSIKAQYYAGPKHIRVLEKIAPHLDLTIDYSWLWFIAK PLFYALDFIHGLVGNWGLAIILLTCCIKLVFFYPSAMSYRSMAKMRKVQPLMNELKERYG DDRQRMSAELMKLYKKEKVNPLGGCLPILLQMPVFIALYWMIMESVELRHAPFFLWIHDL SVRDPYFVLPLIMGVTMWIQQKLNPTPADPMQAKVMQLMPFFFTALFMMFPAGLVLYWVV NNTLSITQQYIITRQIEKAD
Uniprot No.

Target Background

Function

Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. YidC is involved in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, and at least some lipoproteins. It also assists in the folding of multispanning membrane proteins.

Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of YidC in T. turnerae?

YidC in T. turnerae belongs to the YidC-Oxa1-Alb3 family of membrane insertases that catalyze the transmembrane topology of newly synthesized membrane proteins . The protein consists of 5-6 transmembrane helices that contact hydrophobic segments of substrate proteins during insertion . In T. turnerae, YidC (gene locus: TERTU_4739) facilitates proper membrane protein folding and insertion, with the full protein sequence consisting of 560 amino acids . Like other YidC homologs, it likely functions both independently and cooperatively with the Sec translocase to ensure proper assembly of membrane proteins with various topological complexities .

How is YidC evolutionarily conserved across bacterial species?

YidC belongs to a highly conserved family of membrane insertases with homologues found in mitochondria (Oxa1) and thylakoids (Alb3), pointing to a common evolutionary origin . This conservation demonstrates the fundamental importance of this cellular process across different domains of life . While the specific conservation patterns of T. turnerae YidC aren't detailed in current literature, its presence in this facultative endosymbiont is notable as many obligate intracellular symbionts tend to lose non-essential genes during evolutionary transition to an intracellular lifestyle . T. turnerae appears to maintain a more complete genome than many obligate endosymbionts, retaining important machinery for membrane protein insertion .

What expression systems are optimal for recombinant T. turnerae YidC production?

Yeast expression systems have been successfully employed for recombinant production of T. turnerae YidC . This eukaryotic expression system offers advantages for membrane protein expression, potentially providing appropriate chaperones and membrane environments for proper folding. For researchers developing expression protocols, considerations should include:

  • Codon optimization for the expression host

  • Selection of appropriate promoters (constitutive vs. inducible)

  • Signal sequence design for proper membrane targeting

  • Fusion tags that facilitate purification while minimizing functional interference

  • Growth temperature optimization to balance expression levels with proper folding

Alternative expression systems such as E. coli or cell-free systems might be explored depending on specific research requirements.

What purification strategies maintain functional integrity of T. turnerae YidC?

Purifying membrane proteins like YidC presents significant challenges due to their hydrophobic nature. Based on commercial preparations, recombinant T. turnerae YidC can be stabilized in Tris-based buffer containing 50% glycerol . A general purification workflow would include:

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using mild detergents (e.g., DDM, LMNG)

  • Affinity chromatography utilizing fusion tags

  • Size exclusion chromatography for final purification

  • Buffer exchange into stabilizing buffer containing glycerol

The purity of commercially available recombinant T. turnerae YidC has been reported as >85% by SDS-PAGE , providing a benchmark for laboratory-scale purification efforts.

How can storage conditions be optimized for maintaining YidC stability?

Long-term stability of recombinant T. turnerae YidC depends on proper storage conditions. For liquid preparations, storage at -20°C/-80°C provides a shelf life of approximately 6 months, while lyophilized forms can be stable for up to 12 months at the same temperatures . Working aliquots should be stored at 4°C and used within one week .

Additional stability recommendations include:

  • Avoid repeated freeze-thaw cycles

  • Centrifuge vials briefly before opening

  • For reconstitution, use deionized sterile water to achieve 0.1-1.0 mg/mL concentration

  • Maintain glycerol at 5-50% final concentration for long-term storage

  • Consider addition of reducing agents if the protein contains critical cysteine residues

What experimental approaches can determine YidC structure-function relationships?

Several complementary approaches can elucidate structure-function relationships in T. turnerae YidC:

Structural Analysis Methods:

  • X-ray crystallography (challenging for membrane proteins but potentially informative)

  • Cryo-electron microscopy for high-resolution structure determination

  • NMR spectroscopy for dynamic structural information

  • Molecular modeling based on homologous proteins with known structures

Functional Analysis Methods:

  • Site-directed mutagenesis of conserved residues

  • Deletion or truncation analysis to identify essential domains

  • Crosslinking studies to identify interaction sites with substrate proteins

  • In vitro reconstitution assays using purified components

Studies in Lactococcus lactis have demonstrated that deletion of YidC homologs significantly impacts various cellular functions, providing a methodological template for similar investigations in T. turnerae .

How does YidC interact with the Sec translocase in bacterial systems?

While specific details of YidC-Sec interactions in T. turnerae aren't fully characterized, YidC generally cooperates with the Sec translocase in bacterial systems . This cooperation facilitates the assembly of membrane proteins with complex topologies . In Serratia symbiotica, components of both the Sec pathway (including SecA, SecB, SecD, SecF, SecG, SecY) and YidC were identified in the proteome, suggesting coordinated activity of these systems .

To study YidC-Sec interactions in T. turnerae, researchers could employ:

  • Co-immunoprecipitation assays with antibodies against YidC or Sec components

  • Two-hybrid systems to detect protein-protein interactions

  • In vitro reconstitution of the combined YidC-Sec system

  • Proteomics analysis of complexes formed during active membrane protein insertion

How does YidC contribute to T. turnerae's symbiotic lifestyle?

T. turnerae serves as an intracellular endosymbiont in shipworms, contributing cellulolytic enzymes and nitrogen fixation capabilities to its host in nitrogen-restricted woody environments . While YidC's specific role in symbiosis isn't directly established, as a membrane protein insertase, it likely facilitates proper assembly of proteins crucial for symbiotic functions.

YidC may be particularly important for:

  • Proper insertion of transporters involved in nutrient exchange with the host

  • Assembly of secretion system components needed for enzyme export

  • Maintenance of membrane integrity during transitions between free-living and symbiotic states

  • Integration of membrane proteins involved in host-symbiont signaling

T. turnerae appears to be a facultative rather than obligate endosymbiont, lacking the typical genomic reduction seen in many obligate symbionts . This suggests that proteins like YidC, which might be dispensable in some obligate endosymbionts, remain important for T. turnerae's lifestyle.

Is YidC involved in the secretion of cellulolytic enzymes?

T. turnerae produces numerous carbohydrate-active enzymes that degrade cellulose, hemicellulose, and pectin, contributing to lignocellulose digestion in the shipworm gut . Recent research has shown that T. turnerae produces outer membrane vesicles (OMVs) containing various cellulolytic enzymes when grown on carboxymethyl cellulose . These OMVs are enriched with TonB-dependent receptors, which are membrane proteins that might require YidC for proper insertion .

The potential connection between YidC and cellulolytic enzyme secretion could be investigated through:

  • Comparative proteomic analysis of OMVs from wild-type and YidC-depleted strains

  • Enzymatic activity assays measuring cellulolytic function in YidC-depleted conditions

  • Localization studies of cellulases in strains with modified YidC levels

  • Expression pattern comparison of YidC and cellulolytic enzymes under different growth conditions

How can genetic manipulation approaches be used to study YidC function?

Several genetic approaches can be employed to investigate YidC function in T. turnerae:

Gene Knockout/Knockdown:

  • Construction of yidC deletion mutants to assess phenotypic consequences

  • Conditional expression systems to control YidC levels

  • CRISPR-Cas9 genome editing for precise modifications

  • Antisense RNA strategies for partial depletion

Complementation Studies:

  • Expression of yidC variants in knockout strains to identify essential domains

  • Heterologous expression of YidC homologs from other species to test functional conservation

  • Chimeric constructs combining domains from different YidC proteins

Research in T. turnerae has successfully employed genetic manipulation techniques for creating deletion mutants of other genes, such as TonB, providing methodological precedents for YidC studies .

What proteomics approaches can identify YidC substrates?

Identifying the substrate spectrum of YidC in T. turnerae requires sophisticated proteomics approaches:

Differential Proteomics:

  • Comparative membrane proteome analysis between wild-type and YidC-depleted strains

  • Quantitative proteomics using SILAC, TMT, or label-free approaches

  • Pulse-chase experiments to track newly synthesized membrane proteins

Interaction Proteomics:

  • Proximity-dependent biotin identification (BioID) with YidC as bait

  • Cross-linking followed by mass spectrometry (XL-MS)

  • Co-immunoprecipitation coupled with LC-MS/MS

Previous LC-MS/MS analysis of T. turnerae OMVs has successfully identified numerous proteins , demonstrating the feasibility of proteomic approaches with this organism.

How does YidC function compare between free-living and symbiotic states of T. turnerae?

T. turnerae appears capable of both free-living and symbiotic existence , raising questions about potential differential roles of YidC in these different states:

Comparative Expression Analysis:

  • Transcriptomics comparing yidC expression between free-living cultures and bacteria isolated from shipworm gills

  • Proteomics quantifying YidC protein levels in different growth conditions

  • Reporter gene fusions to monitor yidC expression in various environments

Functional Studies:

  • Assessment of membrane protein composition in free-living versus symbiotic states

  • Evaluation of YidC-dependent processes under conditions mimicking the host environment

  • In vivo imaging of fluorescently tagged YidC during host colonization

Understanding potential differences in YidC function between free-living and symbiotic states could provide insights into the molecular adaptations required for the endosymbiotic lifestyle.

How might YidC interact with TonB-dependent iron acquisition in T. turnerae?

T. turnerae contains multiple TonB gene clusters essential for iron acquisition via siderophores . The turnerbactin biosynthetic gene cluster includes a TonB-dependent outer membrane receptor gene (fttA) that is indispensable for iron uptake . As a membrane protein insertase, YidC could potentially facilitate the proper integration of these TonB-dependent receptors into the outer membrane.

Research has shown that:

  • Three TonB clusters containing four tonB genes exist in T. turnerae

  • TonB genes are necessary for growth under iron-limiting conditions

  • TonB-dependent receptors are enriched in outer membrane vesicles produced by T. turnerae

Investigating the potential role of YidC in TonB-dependent receptor assembly could involve:

  • Assessing membrane integration of TonB-dependent receptors in YidC-depleted strains

  • Examining iron acquisition capabilities in YidC mutants

  • Co-localization studies of YidC and TonB components during active expression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.