Recombinant Teredinibacter turnerae Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction

Teredinibacter turnerae is a remarkable marine gamma proteobacterium that exists as an intracellular endosymbiont in the gills of wood-boring bivalves known as shipworms (Family Teredinidae). This unique bacterium plays a critical role in the symbiotic relationship by producing enzymes that help the host digest wood and by fixing nitrogen to supplement the host's nutrition . The complete genome sequence of T. turnerae T7901 has been determined, providing valuable insights into the genetic makeup of this symbiotic organism . The ecological significance of T. turnerae extends beyond its primary host relationship, as it contributes to marine carbon cycling through the degradation of lignocellulosic materials that would otherwise accumulate in marine environments. The molecular machinery enabling these functions includes various enzymes and structural proteins, many of which are likely to be lipoproteins anchored to cellular membranes.

Bacterial lipoproteins are essential components of the cell envelope that perform various functions, including nutrient acquisition, cell wall maintenance, adhesion, and virulence. The biosynthesis of lipoproteins involves a conserved pathway that begins with the action of Prolipoprotein diacylglyceryl transferase (Lgt), an integral membrane enzyme that catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine residue in the lipobox of prolipoproteins . This modification anchors the proteins to the membrane and represents the first step in a three-step process of lipoprotein maturation. The subsequent steps involve the action of signal peptidase II (Lsp) that cleaves the signal peptide and apolipoprotein N-acyltransferase (Lnt) that adds a third acyl chain, resulting in mature triacylated lipoproteins .

The lgt gene is essential for viability in most Gram-negative bacteria, as demonstrated by depletion studies in Escherichia coli . Complementary research has revealed the crystal structure of E. coli Lgt at high resolution (1.6-1.9 Å), showing the presence of two binding sites and providing insights into the catalytic mechanism . Critical residues, including Arg143 and Arg239, have been identified as essential for diacylglyceryl transfer activity in E. coli Lgt . While extensive characterization has been conducted on Lgt from model organisms like E. coli, less is known about this enzyme in symbiotic bacteria such as T. turnerae, presenting an opportunity to explore evolutionary adaptations in this essential enzyme within specialized ecological contexts.

Molecular Mechanism of Lgt

Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the first step in bacterial lipoprotein biogenesis by transferring an sn-1,2-diacylglyceryl group from phosphatidylglycerol to prolipoproteins . Specifically, it transfers this lipid moiety to the sulfhydryl group of a conserved cysteine residue in the lipobox motif of prolipoproteins, forming a thioether linkage. The lipobox is a conserved sequence [L(A/V)-4-L-3-A(S)-2-G(A)-1-C+1] that serves as a recognition signal for the lipoprotein modification machinery, with the invariant cysteine (+1) becoming the first amino acid of the mature protein after modification . The precise recognition of this motif by Lgt ensures the specificity of lipoprotein processing, distinguishing lipoprotein precursors from other secreted proteins in the bacterial cell.

The reaction catalyzed by Lgt results in the formation of a thioether-linked diacylglyceryl-prolipoprotein and glycerolphosphate as a by-product . This modification is critical for anchoring the lipoprotein to the membrane, enabling it to perform its various functions including nutrient uptake, signal transduction, and maintenance of membrane integrity. The anchoring process is particularly important in the context of T. turnerae, whose symbiotic lifestyle may require specialized membrane-associated functions for wood degradation and nitrogen fixation within the host environment. Furthermore, the lipid modification enhances protein stability and may facilitate proper folding and localization of functional domains in the membrane-associated state.

Critical Residues and Catalytic Site

Complementation studies using lgt-knockout cells with different mutant Lgt variants have identified critical residues that are essential for diacylglyceryl transfer activity, including Arg143 and Arg239 in E. coli Lgt . These residues likely play important roles in substrate binding or catalysis, potentially forming ionic interactions with the phosphate group of phosphatidylglycerol or stabilizing reaction intermediates during the transfer process. Site-directed mutagenesis studies of E. coli Lgt have employed cysteine and alanine substitutions to identify essential residues and elucidate the enzyme's membrane topology . These studies have utilized techniques such as the substituted cysteine accessibility method (SCAM) to determine which regions of the protein are accessible from the periplasmic or cytoplasmic face of the membrane .

The identification of these critical residues provides insights into the catalytic mechanism of Lgt and offers potential targets for the development of inhibitors. Conservation analysis of these residues across bacterial species, including T. turnerae, would inform our understanding of evolutionary constraints on Lgt function and potential species-specific adaptations. The functional characterization of Lgt has been described as key to understanding bacterial virulence mechanisms and developing new antibacterial agents , highlighting the importance of identifying and analyzing essential catalytic residues in both model organisms and symbionts like T. turnerae.

Comparison with Lgt from Other Bacterial Species

Table 1: Comparative Analysis of Lgt Characteristics Across Bacterial Species

SpeciesEssential for GrowthKey Functional ResiduesPhysiological Role
E. coliYes Arg143, Arg239 Lipoprotein biosynthesis for membrane integrity
B. anthracisNo Not specified in current literatureSpore germination, virulence factors
T. turneraePresumed essential (based on conservation in Gram-negative bacteria)Predicted to include residues analogous to E. coli Arg143 and Arg239Likely role in symbiotic relationship, possibly in enzyme secretion and nitrogen fixation

The diversity in Lgt characteristics across bacterial species highlights the adaptability of this enzyme to different cellular contexts and ecological requirements. For T. turnerae, which exists as a symbiont in shipworms, the structure and function of Lgt may reflect adaptations to its unique lifestyle, potentially involving specialized lipoproteins associated with wood degradation and nitrogen fixation. Comparative analysis of Lgt across diverse bacterial species, including both pathogens and symbionts, provides insights into the evolution of this essential enzyme and its role in bacterial adaptation to different ecological niches.

Ecological Niche and Symbiotic Relationship

Teredinibacter turnerae is a cultivable intracellular endosymbiont found in the gills of xylotrophic (wood-feeding) bivalves of the Family Teredinidae, commonly known as shipworms . This symbiotic relationship is mutualistic, with T. turnerae providing benefits to its host through its ability to produce enzymes that degrade wood lignocellulose and to fix nitrogen under micro-aerobic conditions . The specialized habitat within shipworm gill tissue represents a protected environment that likely imposes unique selective pressures on T. turnerae, potentially influencing the structure and function of its membrane proteins, including Lgt. The symbiotic nature of T. turnerae distinguishes it from free-living bacteria and model organisms like E. coli, making it a valuable subject for comparative studies of essential cellular processes.

When grown in pure culture, T. turnerae secretes cellulase (endo-1,4-β-D glucanase) and other key enzymes that degrade wood lignocellulose . It also fixes nitrogen when grown micro-aerobically, suggesting that it contributes to the host's ability to survive on an indigestible and nitrogen-deficient diet of wood . These specialized metabolic capabilities may be mediated in part by membrane-associated lipoproteins, whose proper localization and function depend on the Lgt-catalyzed diacylglyceryl transfer. The dual role of T. turnerae in wood degradation and nitrogen fixation represents a remarkable adaptation to its ecological niche and highlights the potential significance of lipoprotein modifications in facilitating these specialized functions.

Genetic Diversity among T. turnerae Isolates

Although T. turnerae has been isolated from many shipworm taxa collected from various locations, genetic diversity within this symbiont species has only recently been explored systematically . Analysis of sequence diversity in fragments of six genes (16S rRNA, gyrB, sseA, recA, rpoB, and celAB) among 25 isolates of T. turnerae cultured from 13 shipworm species collected in 15 locations across the Atlantic, Pacific, and Indian Oceans has provided insights into the genetic structure of this species . This genetic diversity may extend to genes encoding lipoprotein biosynthesis enzymes, including lgt, potentially reflecting adaptations to different host species or environmental conditions.

Table 2: Genetic Diversity Analysis of T. turnerae Isolates Across Different Genomic Loci

GeneSequence VariationPhylogenetic PatternNotable Features
16S rRNAMinimal (<0.26% maximum pairwise difference) Limited differentiationHighly conserved marker, standard for bacterial classification
gyrBModerate to high (within 2.2-5.9% range) Two distinct cladesEvidence of recombinant alleles in some isolates (e.g., PMS-535T.S.1b.3, T8510)
sseAModerate to high (within 2.2-5.9% range) Two distinct cladesSupports primary clade divisions
recAModerate to high (within 2.2-5.9% range) Two distinct cladesEvidence of putative lateral gene transfer in three isolates (T8412, T8503, T8513)
rpoBModerate to high (within 2.2-5.9% range) Two distinct cladesSupports primary clade divisions
celABModerate to high (within 2.2-5.9% range) Two distinct cladesEvidence of recombinant alleles, important for wood degradation functions

These results demonstrate that T. turnerae isolates do not represent a homogeneous global population but instead indicate the emergence of two lineages that, although distinct, likely experience some level of genetic exchange with each other and with other bacterial species . This genetic structure suggests that T. turnerae has undergone adaptive radiation in response to its association with different host species or geographic distribution, potentially leading to variations in protein structure and function, including for lipoprotein biosynthesis enzymes like Lgt. The evidence of recombination and lateral gene transfer further suggests that T. turnerae populations maintain genetic plasticity despite their intracellular lifestyle, which may contribute to functional diversification of key metabolic pathways.

Genomic Features Relevant to Lgt Expression

The complete genome sequence of T. turnerae T7901 has been reported , providing a foundation for understanding the genetic basis of this bacterium's symbiotic lifestyle and its capacity for producing enzymes involved in wood degradation and nitrogen fixation. While specific information about the lgt gene in T. turnerae is not extensively documented in current literature, comparative genomic analysis would likely reveal its presence and conservation, given the essential nature of this gene in most gram-negative bacteria. Genomic analysis could also provide insights into the regulatory elements controlling lgt expression in T. turnerae, which might reflect adaptations to its symbiotic lifestyle.

The genetic diversity observed among T. turnerae isolates suggests that the lgt gene might also exhibit variations across different strains, potentially leading to structural or functional differences in the encoded enzyme. Such variations could reflect adaptations to different host species or environmental conditions, contributing to the successful establishment of symbiotic relationships across diverse ecological contexts. Furthermore, the genomic context of the lgt gene, including adjacent genes and potential operonic structures, could provide insights into the integration of lipoprotein biosynthesis with other cellular processes in T. turnerae, such as secretion systems for wood-degrading enzymes or nitrogen fixation machinery.

Expression Systems for Recombinant Lgt

The recombinant production of T. turnerae Lgt would likely employ strategies similar to those used for the expression of other membrane proteins, particularly those from gram-negative bacteria. Expression systems for recombinant Lgt would typically involve bacterial hosts such as E. coli, with optimization strategies to enhance membrane protein expression and stability. The use of fusion tags, such as the c-myc tag employed for E. coli Lgt , would facilitate detection and purification of the recombinant protein. Selection of appropriate expression vectors with tunable promoters would allow modulation of expression levels to prevent toxicity associated with membrane protein overexpression.

Given the challenges associated with membrane protein expression, alternative approaches might include the use of specialized E. coli strains designed for membrane protein production, or homologous expression in T. turnerae itself. The latter approach, while technically more challenging, might preserve native folding and post-translational modifications that could be important for Lgt function. Codon optimization of the T. turnerae lgt gene for expression in heterologous hosts would likely improve translation efficiency and protein yield, facilitating structural and functional studies of the recombinant enzyme.

Purification Methods

Purification of recombinant T. turnerae Lgt would typically involve solubilization of the membrane protein using detergents, followed by affinity chromatography using fusion tags. The choice of detergent is critical for maintaining protein stability and activity, with mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) often preferred for membrane protein purification. The search results mention that E. coli Lgt can be solubilized in an active form , suggesting that similar approaches might be applicable to T. turnerae Lgt. Following detergent solubilization, affinity chromatography using tags such as His-tag or c-myc tag would allow selective purification of the recombinant protein.

Further purification steps might include ion exchange chromatography and size exclusion chromatography to achieve high purity and homogeneity. These chromatographic methods would separate the recombinant Lgt from contaminating proteins and detergent micelles, facilitating subsequent structural and functional analyses. Protein samples would be analyzed by techniques such as SDS-PAGE and immunoblotting to confirm the presence and purity of the recombinant Lgt . The use of antibodies against specific tags or against the Lgt protein itself would facilitate detection and quality control throughout the purification process.

Functional Assays

Functional characterization of recombinant T. turnerae Lgt would require assays to measure its diacylglyceryl transferase activity. Based on studies of E. coli Lgt, these assays might include in vitro assays measuring the transfer of radiolabeled or fluorescently-labeled diacylglyceryl groups from phosphatidylglycerol to synthetic prolipoprotein substrates. The search results mention a GFP-based in vitro assay used to correlate the activities of E. coli Lgt with structural observations , suggesting that similar approaches could be applied to T. turnerae Lgt. These assays would provide quantitative measures of enzyme activity and allow comparison with Lgt from other bacterial species.

Complementation assays, where the recombinant T. turnerae Lgt is expressed in an lgt-knockout bacterial strain to test whether it can restore growth, would provide evidence for functional activity in vivo . Such complementation studies have been used effectively to identify essential residues in E. coli Lgt through site-directed mutagenesis , and similar approaches could be applied to T. turnerae Lgt. The development of specific assays for T. turnerae Lgt activity would contribute significantly to our understanding of lipoprotein biosynthesis in this symbiotic bacterium and might reveal adaptations in enzyme activity or substrate specificity related to its ecological niche.

Biotechnological Applications

The study of recombinant T. turnerae Lgt has several potential biotechnological applications, particularly in the context of T. turnerae's unique enzymatic capabilities. As a symbiont of wood-boring bivalves, T. turnerae produces a variety of enzymes that efficiently degrade lignocellulosic materials, including cellulases and hemicellulases . Some of these enzymes may be lipoproteins or may require lipoproteins for proper localization or activity. Understanding the role of Lgt in processing these proteins could contribute to the development of improved biocatalysts for biomass degradation and biofuel production. The efficient degradation of lignocellulose remains a significant challenge in bioenergy production, and insights from T. turnerae's enzymatic machinery could lead to innovative solutions.

Additionally, T. turnerae produces enzymes with activities such as transglycosylase activity toward β-1,3-oligosaccharides , which could have industrial applications in the production of bioactive oligosaccharides or in glycoengineering. Understanding how lipoproteins contribute to these enzymatic activities could inform biotechnological applications in these fields. Furthermore, the study of Lgt from T. turnerae could provide insights into membrane protein engineering and the development of improved expression systems for difficult-to-express membrane proteins, which remain a significant challenge in structural biology and biotechnology.

Understanding Bacterial Symbiosis

T. turnerae represents a model system for studying bacterial symbiosis, particularly in the context of marine environments. The role of lipoproteins in establishing and maintaining symbiotic relationships is an area of active research, and understanding the function of Lgt in T. turnerae could provide insights into this aspect of symbiosis. Lipoproteins may be involved in host-symbiont recognition, nutrient exchange, or signaling processes that facilitate the establishment and maintenance of the symbiotic relationship. The genetic diversity observed among T. turnerae isolates suggests that there may be adaptations in lipoprotein processing related to specific host associations or environmental conditions.

The symbiotic relationship between T. turnerae and shipworms is particularly interesting because it involves intracellular residence of the bacterium in specialized gill cells, combined with the production of enzymes that aid in the host's unusual diet of wood . This complex interaction likely requires sophisticated coordination between host and symbiont, potentially mediated by lipoproteins or other membrane-associated components. Understanding the role of Lgt in this symbiotic relationship could provide insights into the molecular mechanisms of symbiosis more broadly, with implications for understanding other host-microbe interactions in marine and terrestrial environments.

Antimicrobial Development

Lgt is essential for viability in most Gram-negative bacteria and plays a role in virulence in some Gram-positive bacteria . This makes it a potential target for antimicrobial development. The crystal structure of E. coli Lgt has been determined in complex with an inhibitor (palmitic acid) , suggesting that structure-based drug design approaches could be applied to develop inhibitors of Lgt as potential antimicrobial agents. Understanding the structure and function of T. turnerae Lgt could contribute to this effort by providing additional structural and functional data from a different bacterial species, potentially revealing conserved features that could be targeted by broad-spectrum antimicrobial agents.

The identification of critical residues for Lgt function, such as Arg143 and Arg239 in E. coli Lgt , provides specific targets for rational drug design. If these residues are conserved in T. turnerae Lgt and across other bacterial species, they could represent ideal targets for the development of inhibitors that disrupt lipoprotein biosynthesis. Given the essential nature of this process in most gram-negative bacteria, such inhibitors could have broad-spectrum antimicrobial activity. Furthermore, the specificity of the bacterial lipoprotein biosynthesis pathway, which is absent in eukaryotes, makes it an attractive target for antimicrobial development with minimal risk of toxicity to human cells.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; TERTU_0364; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Teredinibacter turnerae (strain ATCC 39867 / T7901)
Target Names
lgt
Target Protein Sequence
MLKYPEIDPVALSLGSVTVFGKTINLPDIHWYGLMYLFGFILCWAVGTYRAGKPHNVVHK SWLEDLVFYVAMGVVLGGRCGYVFFYNFGAFLDDPLWLFRVWEGGMSFHGGLLGVILAMM LYARKMQVRFLDLMDFVAPLVPIGLGLGRIGNFIGQELWGRVTTLPIGMVFPKDPGVARH PSQLYQAALEGLVLFAVLFWFSSKPRPRAAVASLFLILYGCFRFAVEFVREPDAHIGFDM FGWLTRGQELSLPMIIIGALIFFYAYRHPAYAEKAPDPRANGSKKG
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Teredinibacter turnerae and why is it significant in research?

Teredinibacter turnerae is a marine gamma proteobacterium that functions as an intracellular endosymbiont in the gills of wood-boring marine bivalves of the family Teredinidae (commonly known as shipworms). This bacterium is uniquely positioned in scientific research as the sole cultivated member of an endosymbiotic consortium that provides host shipworms with critical enzymes, including cellulases and nitrogenase. These enzymes are essential for the digestion of wood and supplementation of the host's nitrogen-deficient diet, making T. turnerae a model organism for studying symbiotic relationships in marine environments . Unlike many obligate intracellular symbionts, T. turnerae lacks typical features associated with obligate intracellular existence such as reduced genome size or loss of core metabolic genes, suggesting it is a facultative symbiont that may also exist in a free-living state. This unique biological profile makes T. turnerae particularly valuable for studying evolutionary adaptations associated with endosymbiosis and the enzymatic mechanisms involved in plant material degradation in marine environments .

What is the function of prolipoprotein diacylglyceryl transferase (lgt)?

Prolipoprotein diacylglyceryl transferase (lgt) is an integral membrane enzyme that catalyzes the first and critical step in bacterial lipoprotein biosynthesis. Specifically, lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of the conserved cysteine residue in the lipobox motif of prolipoproteins . This post-translational modification is essential for anchoring lipoproteins to bacterial membranes. In T. turnerae, as in other bacteria, this process is vital since lipoproteins perform diverse functions including cell envelope maintenance, nutrient uptake, transport, adhesion, and virulence. The genome of T. turnerae encodes over 180 predicted lipoproteins, underscoring the significance of lgt function in this organism . The enzyme's importance is further highlighted by the fact that deletion of the lgt gene is lethal to most Gram-negative bacteria, positioning it as a potential target for antimicrobial development .

What expression systems are most effective for producing recombinant T. turnerae lgt?

For the recombinant expression of T. turnerae lgt, researchers should consider several expression systems with specific modifications to accommodate this integral membrane enzyme:

For optimal expression, the following methodological considerations are essential:

  • Use of a low-copy number plasmid with a tightly regulated promoter

  • Inclusion of a fusion tag (e.g., His6, MBP, or SUMO) to facilitate purification and potentially enhance solubility

  • Induction at lower temperatures (16-20°C) for extended periods (16-24 hours) with reduced inducer concentration

  • Supplementation with additional phospholipids or specific detergents during expression

Expression trials should systematically evaluate these variables using small-scale cultures before scaling up to production levels. Western blotting with anti-His (or appropriate tag) antibodies can verify expression, while activity assays using synthetic substrates can confirm functional expression.

What purification strategies overcome challenges associated with membrane proteins like lgt?

Purifying recombinant T. turnerae lgt requires specialized approaches to address its membrane-associated nature:

Step 1: Membrane fraction isolation

  • Harvest cells and disrupt by sonication or French press in buffer containing protease inhibitors

  • Remove unbroken cells and debris by low-speed centrifugation (10,000 × g, 20 min)

  • Isolate membrane fraction by ultracentrifugation (100,000 × g, 1 hour)

  • Wash membrane pellet to remove peripheral proteins

Step 2: Solubilization

  • Resuspend membrane fraction in buffer containing appropriate detergents

  • Recommended detergents include n-dodecyl-β-D-maltoside (DDM), n-decyl-β-D-maltoside (DM), or LDAO

  • Solubilize with gentle agitation (4°C, 1-2 hours)

  • Remove insoluble material by ultracentrifugation

Step 3: Affinity chromatography

  • Apply solubilized fraction to appropriate affinity resin (Ni-NTA for His-tagged constructs)

  • Include detergent at concentrations above critical micelle concentration (CMC) in all buffers

  • Use gradual imidazole gradient for elution to reduce co-purification of contaminants

Step 4: Secondary purification

  • Size exclusion chromatography to separate protein-detergent complexes from aggregates and excess detergent micelles

  • Ion exchange chromatography may provide additional purification if required

Recommended buffer compositions:

  • Extraction buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM DTT, protease inhibitor cocktail

  • Solubilization buffer: Extraction buffer + 1% DDM (or alternative detergent)

  • Chromatography buffers: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 0.05% DDM

Protein purity should be assessed by SDS-PAGE and activity by functional assays. For structural studies, detergent exchange or reconstitution into nanodiscs or liposomes may be necessary.

How can researchers assess the functional integrity of purified recombinant T. turnerae lgt?

To confirm that purified recombinant T. turnerae lgt maintains its native functional properties, researchers should implement a multi-faceted approach:

  • In vitro diacylglyceryl transferase assay:

    • Prepare synthetic peptide substrates containing the lipobox motif

    • Incubate purified lgt with substrate peptide and fluorescently labeled phosphatidylglycerol

    • Monitor transfer reaction by TLC, HPLC, or mass spectrometry

    • Quantify reaction rate under varying conditions (pH, temperature, ion concentration)

  • GFP-based activity assay:

    • Similar to approaches used with E. coli lgt, create fusion constructs of substrate peptides with GFP

    • Measure changes in fluorescence upon diacylglyceryl transfer

    • This approach allows for real-time monitoring of activity

  • Complementation assays in conditional lgt mutants:

    • Transform temperature-sensitive or inducible lgt mutant strains with T. turnerae lgt

    • Assess functional complementation by growth under restrictive conditions

    • This approach provides evidence of in vivo functionality

  • Circular dichroism spectroscopy:

    • Analyze secondary structure content of purified lgt

    • Compare with predicted secondary structure elements from homology models

    • Verify proper folding of recombinant protein

  • Ligand binding assays:

    • Use isothermal titration calorimetry or microscale thermophoresis to measure binding of substrates

    • Determine binding constants for comparison with enzymes from other species

    • Analyze the effects of mutations at conserved residues (e.g., Arg143, Arg239 equivalents)

Assessment MethodPrimary InformationTechnical RequirementsLimitations
In vitro enzyme assayDirect activity measurementLC-MS or radioactive substratesMay not reflect in vivo conditions
GFP-based assayReal-time activity monitoringFluorescence spectroscopyFusion may affect enzyme activity
Complementation assayIn vivo functionalityBacterial genetics expertiseStrain-specific effects
Circular dichroismProper protein foldingCD spectropolarimeterLimited structural resolution
Ligand bindingSubstrate interaction kineticsITC or MST instrumentationDoes not confirm catalytic activity

Complete functional characterization should include determination of kinetic parameters (Km, Vmax, kcat) under physiologically relevant conditions, as well as substrate specificity analyses comparing various phospholipid donors.

How do structural features of T. turnerae lgt relate to its catalytic mechanism?

Based on structural studies of lgt from E. coli and sequence analysis of T. turnerae lgt, several key structural features are likely critical for the catalytic mechanism:

The active site of lgt contains a conserved catalytic architecture characterized by specific arginine residues (equivalent to Arg143 and Arg239 in E. coli) that are essential for diacylglyceryl transfer . These positively charged residues likely facilitate binding of the negatively charged phosphate group of phosphatidylglycerol and stabilize the transition state during catalysis. The enzyme possesses two distinct binding sites: one for the phospholipid substrate and another for the prolipoprotein acceptor, enabling the coordinated transfer reaction .

The lateral entry mechanism observed in E. coli lgt, where substrates and products enter and exit the enzyme laterally with respect to the membrane bilayer, is likely conserved in T. turnerae lgt as well . This mechanism is crucial for allowing access to both the membrane-embedded phospholipid substrate and the partially membrane-associated prolipoprotein.

For researchers investigating T. turnerae lgt structure-function relationships, targeted mutagenesis of conserved residues followed by functional assays would provide valuable insights. Specific approaches include:

  • Site-directed mutagenesis of predicted catalytic residues

  • Truncation analysis to define domain boundaries essential for activity

  • Chimeric constructs incorporating domains from other bacterial lgt enzymes

  • Molecular dynamics simulations to model substrate binding and product release

These approaches would help elucidate the unique aspects of T. turnerae lgt function in the context of its symbiotic lifestyle within shipworm gills.

How can researchers design experiments to investigate the role of lgt in T. turnerae symbiosis?

Investigating the role of lgt in T. turnerae symbiosis requires carefully designed experimental approaches that bridge molecular biology, biochemistry, and symbiosis studies:

Genetic manipulation strategies:

  • Develop a conditional knockout system for T. turnerae lgt using inducible promoters or temperature-sensitive alleles, as complete deletion would likely be lethal

  • Create point mutations in catalytic residues to generate partially functional variants

  • Establish complementation systems with wild-type or mutant lgt alleles

Host-symbiont interaction studies:

  • Inoculate aposymbiotic (symbiont-free) juvenile shipworms with wild-type or lgt-modified T. turnerae strains

  • Monitor colonization efficiency, symbiont persistence, and host development

  • Analyze the lipoproteome in successful versus unsuccessful colonization attempts

Lipoprotein localization experiments:

  • Generate fluorescent protein fusions with selected T. turnerae lipoproteins

  • Observe their localization in wild-type bacteria versus lgt-deficient strains

  • Examine lipoprotein distribution in the context of shipworm gill tissue

Environmental condition impact:

  • Analyze lgt expression levels under various conditions mimicking the shipworm gill environment

  • Determine how temperature, pH, salinity, and nutrient availability affect lgt activity

  • Investigate potential regulatory mechanisms controlling lgt expression during different stages of symbiosis

Experimental design considerations:

  • Include appropriate controls for each experiment

  • Use multiple independent mutant strains to confirm phenotypes

  • Combine in vitro biochemical assays with in vivo symbiosis studies

  • Develop standardized protocols for shipworm colonization experiments

  • Apply statistical analysis methods appropriate for symbiosis experiments

These approaches would provide comprehensive insights into how lgt function contributes to the establishment and maintenance of the T. turnerae-shipworm symbiotic relationship.

What experimental controls are essential when working with recombinant T. turnerae lgt?

When designing experiments with recombinant T. turnerae lgt, implementing appropriate controls is critical for data validity and interpretation:

Expression and purification controls:

  • Negative expression control: Host cells transformed with empty vector to identify background protein bands and endogenous activities

  • Inactive enzyme control: Site-directed mutant of T. turnerae lgt with substitutions at catalytic residues (equivalent to R143A and R239A in E. coli)

  • Protein quality control: Thermal stability assay (TSA) or circular dichroism to verify proper protein folding

  • Detergent-only control: Sample containing only the detergent used for solubilization to identify detergent artifacts

Enzymatic activity controls:

  • No-enzyme control: Reaction mixture lacking the enzyme to identify non-enzymatic modifications

  • Heat-inactivated enzyme control: Boiled enzyme preparation to confirm activity loss

  • Positive control enzyme: Well-characterized lgt from E. coli or other species for comparative analysis

  • Substrate specificity control: Non-lipobox peptides to confirm sequence-specific modification

  • Phospholipid donor specificity: Various phospholipids to verify donor preference

Statistical and experimental design controls:

  • Technical replicates: Minimum of three replicates for each experimental condition

  • Biological replicates: Independent protein preparations from different expression batches

  • Randomization: Random assignment of samples to eliminate systematic errors

  • Blinding: Blinded analysis of results where appropriate to eliminate bias

  • Standard curves: For quantitative measurements including protein concentration and activity

Implementing a factorial experimental design for optimization studies can efficiently identify optimal conditions and potential interactions between variables such as pH, temperature, salt concentration, and detergent type . This approach would generate a comprehensive understanding of factors influencing T. turnerae lgt activity in vitro.

How can researchers address data discrepancies in T. turnerae lgt functional studies?

When faced with conflicting or unexpected data in T. turnerae lgt studies, researchers should implement a systematic troubleshooting approach:

Methodological verification:

  • Confirm protein identity and purity by mass spectrometry and SDS-PAGE

  • Verify protein concentration using multiple methods (Bradford, BCA, A280)

  • Assess enzyme stability under experimental conditions using dynamic light scattering or size exclusion chromatography

  • Evaluate detergent effects by testing multiple detergent types at various concentrations

Data analysis strategies:

  • Identify outliers using statistical methods (e.g., Grubb's test) but examine them carefully before exclusion

  • Apply appropriate transformation methods for non-normally distributed data

  • Use non-parametric tests when assumptions of parametric tests are violated

  • Consider Bayesian analysis approaches for complex datasets with multiple variables

Common sources of data discrepancies:

  • Membrane protein aggregation: Can cause activity loss or variability

    • Solution: Optimize detergent conditions or consider nanodiscs/liposomes for reconstitution

  • Substrate degradation: Especially with peptide substrates

    • Solution: Include protease inhibitors and verify substrate integrity by mass spectrometry

  • Detergent interference with assays: Particularly problematic with colorimetric assays

    • Solution: Include appropriate blanks and consider alternative detection methods

  • Batch-to-batch variation: Common with recombinant membrane proteins

    • Solution: Pool multiple preparations or normalize to a standard activity

  • Environmental sensitivity: pH, temperature, or ionic strength fluctuations

    • Solution: Rigorous control and monitoring of reaction conditions

Discrepancy TypePotential CausesVerification MethodResolution Strategy
Activity loss over timeProtein instabilityThermal shift assayBuffer optimization
Variable yieldExpression conditionsWestern blot analysisStandardize growth parameters
Inconsistent kineticsHeterogeneous proteinSEC-MALS analysisImproved purification protocol
Substrate specificity variationContaminating enzymesActivity with specific inhibitorsAdditional purification steps
pH optimum shiftsBuffer componentsActivity in alternative buffersStandardize buffer components

When reporting conflicting results, researchers should clearly document all experimental conditions, present all data (including outliers), and discuss possible explanations for discrepancies, contributing to greater transparency and reproducibility in the field .

What statistical approaches best analyze structure-function relationships in T. turnerae lgt?

Analyzing structure-function relationships in T. turnerae lgt requires sophisticated statistical approaches to handle complex, multidimensional data:

Multivariate analysis techniques:

  • Principal Component Analysis (PCA): Reduces dimensionality of datasets with multiple variables (e.g., various mutations and multiple activity parameters)

  • Hierarchical Clustering: Groups mutations with similar functional effects

  • Partial Least Squares (PLS) regression: Correlates structural parameters with functional outcomes

  • Multiple Linear Regression: Identifies which structural features best predict functional changes

Experimental design for statistical robustness:

  • Factorial design: Systematically varies multiple factors to identify interactions

  • Response surface methodology: Optimizes conditions for enzyme activity

  • Latin square design: Controls for batch effects and other confounding variables

  • Power analysis: Determines appropriate sample sizes for detecting meaningful effects

Analysis of mutation effects:

  • Calculate ΔΔG values for stability changes using computational tools

  • Correlate changes in kinetic parameters with structural perturbations

  • Apply Quantitative Structure-Activity Relationship (QSAR) models

  • Use molecular dynamics simulations to analyze how mutations affect substrate binding

Implementation example:
For a systematic analysis of T. turnerae lgt catalytic residues, design an experiment testing 5-10 conserved residues with 3-4 different amino acid substitutions at each position. For each variant, measure:

  • Expression level

  • Thermal stability

  • Kinetic parameters (Km, kcat)

  • Substrate specificity

Analyze this dataset using PCA to identify which mutations cluster together functionally, then apply multiple regression to correlate structural features (e.g., side chain volume, hydrophobicity) with functional outcomes.

Advanced considerations:

  • Apply Bayesian statistical frameworks when prior information is available

  • Use bootstrapping or jackknife resampling for robust error estimation

  • Implement mixed-effects models for experiments with batch variations

  • Consider machine learning approaches for complex datasets with many variables

By applying these rigorous statistical approaches, researchers can move beyond simple descriptive analyses to develop predictive models of how specific structural features contribute to T. turnerae lgt function.

What are common expression and purification challenges with recombinant T. turnerae lgt?

Researchers frequently encounter specific challenges when working with recombinant T. turnerae lgt, a membrane-associated enzyme. These challenges and their solutions include:

Expression challenges:

  • Low expression levels:

    • Optimize codon usage for expression host

    • Test multiple promoter systems (T7, tac, araBAD)

    • Evaluate expression at lower temperatures (16-20°C)

    • Consider specialized strains like C41(DE3) or C43(DE3)

  • Protein aggregation/inclusion bodies:

    • Reduce induction strength (lower IPTG concentration)

    • Co-express with chaperones (GroEL/ES, DnaK/J)

    • Add membrane-stabilizing compounds (glycerol, specific lipids)

    • Fuse with solubility-enhancing tags (MBP, SUMO)

  • Proteolytic degradation:

    • Use protease-deficient strains (BL21, Rosetta-gami)

    • Include protease inhibitors during extraction

    • Optimize harvesting time to collect cells before degradation occurs

Purification challenges:

  • Inefficient solubilization:

    • Screen multiple detergents (DDM, DM, LDAO, LMNG)

    • Optimize detergent:protein ratio

    • Test various solubilization times and temperatures

    • Consider mixed detergent systems

  • Co-purification of contaminants:

    • Implement two-step affinity purification (e.g., His-tag plus second affinity tag)

    • Add intermediate ion-exchange chromatography step

    • Use size exclusion chromatography as final polishing step

    • Increase washing stringency in affinity steps

  • Detergent-induced artifacts:

    • Determine minimum detergent concentration needed for stability

    • Consider detergent exchange during purification

    • Evaluate reconstitution into nanodiscs or liposomes

Stability challenges:

  • Activity loss during storage:

    • Test various stabilizing additives (glycerol, specific lipids, reducing agents)

    • Evaluate storage in different physical states (solution, frozen, lyophilized)

    • Determine optimal buffer components through thermal shift screening

    • Consider flash-freezing small aliquots to minimize freeze-thaw cycles

Diagnostic approaches:

  • Analytical size exclusion chromatography to assess oligomeric state

  • Dynamic light scattering to detect aggregation

  • Limited proteolysis to identify stable domains

  • Mass spectrometry to confirm protein identity and detect modifications

By systematically addressing these challenges, researchers can significantly improve the yield and quality of recombinant T. turnerae lgt for structural and functional studies.

How can researchers optimize activity assays for T. turnerae lgt?

Developing robust and reproducible activity assays for T. turnerae lgt requires careful optimization of multiple parameters:

Substrate optimization:

  • Peptide substrate design:

    • Test various lengths of peptides containing the lipobox motif

    • Vary amino acid composition flanking the lipobox

    • Consider using peptides derived from native T. turnerae prolipoproteins

    • Incorporate fluorescent or chromogenic labels for direct detection

  • Phospholipid donor selection:

    • Compare various phospholipids (PG, PE, PS) as donors

    • Test different acyl chain lengths and saturations

    • Use synthetic phospholipids with defined composition

    • Consider fluorescently labeled phospholipids for FRET-based assays

Reaction condition optimization:

  • Buffer composition:

    • Screen pH range (typically pH 6.5-8.5)

    • Test various buffer systems (Tris, HEPES, phosphate)

    • Optimize salt concentration (50-500 mM NaCl)

    • Evaluate divalent cation requirements (Mg²⁺, Mn²⁺, Ca²⁺)

  • Detergent considerations:

    • Determine minimum detergent concentration required

    • Test multiple detergent types compatible with assay

    • Consider detergent:lipid:protein ratios

    • Validate that detergent doesn't interfere with detection method

Detection method optimization:

  • Direct product detection:

    • HPLC separation with UV or fluorescence detection

    • Mass spectrometry for direct product identification

    • TLC with appropriate staining or radioisotope detection

  • Coupled assay approaches:

    • Link diacylglyceryl transfer to a secondary enzymatic reaction

    • Develop FRET-based assays for real-time monitoring

    • GFP-based assays similar to those used with E. coli lgt

Assay validation:

  • Linearity: Establish linear range with respect to enzyme concentration and time

  • Reproducibility: Determine intra-assay and inter-assay variation coefficients

  • Specificity: Confirm activity is abolished with catalytically inactive mutants

  • Sensitivity: Determine lower limit of detection and quantification

Optimization strategy table:

ParameterStarting PointOptimization RangeEvaluation Method
pH7.56.0-9.0 in 0.5 increments% relative activity
NaCl150 mM0-500 mM in 50 mM increments% relative activity
Detergent0.03% DDM0.01-0.1% of 3-5 detergent typesEnzyme stability and activity
Temperature30°C20-45°C in 5°C incrementsInitial velocity and stability
Peptide length15 aa10-25 aaKm and kcat determination
Divalent cationsNone1-10 mM Mg²⁺, Mn²⁺, Ca²⁺% activation or inhibition

By systematically optimizing these parameters, researchers can develop sensitive and specific assays for T. turnerae lgt that allow for accurate kinetic characterization and inhibitor screening.

What approaches resolve substrate specificity questions for T. turnerae lgt?

Determining substrate specificity of T. turnerae lgt requires comprehensive analysis of both the prolipoprotein acceptor and phospholipid donor preferences:

Prolipoprotein acceptor specificity:

  • Lipobox motif analysis:

    • Create a peptide library with systematic variations of the canonical lipobox motif [L/V/I]-[A/S/T/G]-[G/A]-C

    • Test activity with each variant peptide substrate

    • Use position-specific scoring matrices to quantify preferences

    • Compare with known T. turnerae lipoproteins from genomic data

  • Flanking sequence effects:

    • Evaluate the influence of amino acids adjacent to the lipobox

    • Test the effects of charge distribution around the lipobox

    • Analyze secondary structure propensities and their impact

    • Create chimeric substrates with varied N-terminal and C-terminal regions

Phospholipid donor specificity:

  • Headgroup preferences:

    • Compare activity with phosphatidylglycerol, phosphatidylethanolamine, phosphatidylcholine, and phosphatidylserine

    • Determine kinetic parameters for each phospholipid type

    • Analyze competitive utilization in mixed substrate systems

  • Acyl chain specificity:

    • Test phospholipids with varying chain lengths (C12-C20)

    • Compare saturated versus unsaturated acyl chains

    • Evaluate the impact of branched chains and cyclopropane modifications

    • Determine if T. turnerae lgt shows position-specific preferences (sn-1 vs. sn-2)

Advanced analytical approaches:

  • Proteomics-based analysis:

    • Identify all lipid-modified proteins in T. turnerae using mass spectrometry

    • Analyze lipobox sequences for common motifs

    • Compare with predicted lipoproteome from genomic data

    • Identify unconventional lipoboxes that may be specific to T. turnerae

  • Structural analysis of enzyme-substrate interactions:

    • Perform molecular docking simulations with various substrates

    • Create homology models based on E. coli lgt crystal structure

    • Identify potential binding pocket residues that confer specificity

    • Validate through site-directed mutagenesis and activity assays

  • High-throughput screening approaches:

    • Develop a fluorescence-based assay suitable for microplate format

    • Screen libraries of peptide substrates and phospholipid donors

    • Apply multivariate analysis to identify specificity patterns

    • Validate hits with detailed kinetic characterization

Comparative analysis with related organisms:

  • Compare substrate preferences of T. turnerae lgt with enzymes from related free-living marine bacteria

  • Analyze how substrate specificity correlates with the organism's ecological niche

  • Evaluate if endosymbiotic lifestyle has influenced substrate recognition patterns

By integrating these approaches, researchers can develop a comprehensive model of T. turnerae lgt substrate specificity that accounts for both the uniqueness of its symbiotic lifestyle and the fundamental constraints of the lipoprotein modification pathway.

What are the key research priorities for advancing T. turnerae lgt studies?

Future research on T. turnerae prolipoprotein diacylglyceryl transferase should focus on several priority areas to advance our understanding of this enzyme in the context of marine endosymbiosis and bacterial lipoprotein biosynthesis:

  • Structural characterization: Determining the three-dimensional structure of T. turnerae lgt would provide critical insights into its mechanism and evolution. Researchers should pursue X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy approaches, potentially using the E. coli lgt structure as a molecular replacement template .

  • Functional genomics in the host context: Developing genetic tools for manipulating T. turnerae within the shipworm symbiosis would enable investigation of how lgt function influences colonization, persistence, and metabolic exchanges. This includes creating conditional mutants and fluorescent reporters to observe lipoprotein localization in situ.

  • Comparative biochemistry: Systematic comparison of T. turnerae lgt with homologs from free-living marine bacteria and other endosymbionts would reveal adaptations associated with the symbiotic lifestyle. This should include detailed kinetic analyses and substrate preference studies under conditions mimicking the shipworm gill environment.

  • Lipoproteome characterization: Comprehensive identification and functional classification of all lipid-modified proteins in T. turnerae would provide context for understanding the biological significance of lgt activity. This should be coupled with localization studies to determine how lipoproteins are distributed between the bacterial cell surface and the host interface.

  • Inhibitor development and testing: Designing specific inhibitors of T. turnerae lgt could serve as valuable research tools and potentially inform antimicrobial development strategies, given the essential nature of lgt in most Gram-negative bacteria .

These research priorities would significantly advance our understanding of lipoprotein biosynthesis in T. turnerae and provide insights into the molecular mechanisms underlying successful marine endosymbiosis. The findings would have broader implications for bacterial cell envelope biology, host-microbe interactions, and potentially biotechnological applications related to enzyme-mediated degradation of plant materials.

How can T. turnerae lgt research contribute to broader scientific understanding?

Research on T. turnerae prolipoprotein diacylglyceryl transferase offers insights with far-reaching implications across multiple scientific domains:

In evolutionary biology, T. turnerae presents a fascinating case study of a facultative endosymbiont that maintains genomic features of free-living bacteria while adapting to an intracellular lifestyle . Studying its lgt enzyme provides a window into how essential cellular processes are maintained and modified during the transition to endosymbiosis. This contributes to our understanding of the evolutionary continuum between free-living bacteria, facultative symbionts, and obligate endosymbionts.

For marine microbiology and ecology, T. turnerae's role in wood degradation in marine environments represents an important biogeochemical process . The lipoproteins processed by lgt likely include enzymes involved in cellulose degradation and nitrogen fixation, contributing to carbon and nitrogen cycling in marine ecosystems. This research connects molecular mechanisms to ecosystem-level processes.

In structural biology, comparative analysis of lgt enzymes across bacterial species, including T. turnerae, enhances our understanding of membrane protein structure-function relationships. The unique environmental conditions experienced by T. turnerae may have selected for specific adaptations in its membrane-associated enzymes, providing insights into how proteins evolve to function in specialized niches.

For biotechnology applications, T. turnerae encodes numerous enzymes for complex polysaccharide degradation that could have applications in biofuel production . Understanding how these enzymes are processed and localized through the lgt pathway could facilitate their heterologous expression and optimization for industrial processes.

In the field of host-microbe interactions, studying how T. turnerae lipoproteins influence recognition by and communication with the host shipworm provides models for understanding other symbiotic systems. This knowledge has potential applications in agriculture, where engineering beneficial plant-microbe interactions could improve crop resilience and productivity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.