Recombinant Tetraodon nigroviridis ATP synthase subunit a (mt-atp6)

Shipped with Ice Packs
In Stock

Description

Functional Role in Oxidative Phosphorylation

The mt-atp6 protein is a core component of ATP synthase (Complex V), which catalyzes the final step of oxidative phosphorylation. Specifically:

  • Proton Translocation: Subunit a facilitates proton movement across the mitochondrial inner membrane, creating a proton gradient .

  • ATP Synthesis: The energy from proton flow drives the conversion of ADP to ATP via the F1 subunit .

Key Interactions

Interacting ProteinRole in ATP Synthase ComplexSource
ATP5F1A (Subunit α)Catalytic core (F1 domain)
H3CU49_TETNG (OSCP)Peripheral stalk stabilizing F0 and F1 domains
H3D521_TETNG (γ)Central stalk coupling proton flow to ATP synthesis

Functional Studies in Yeast Models

Mutations in mt-atp6 linked to mitochondrial diseases (e.g., Leigh syndrome, NARP) have been studied in yeast systems:

Mutation (Human)Equivalent Yeast MutationBiochemical ImpactOutcomeSource
m.8950G>A (p.V142I)a.V159IImpaired proton pumping efficiencyReduced ATP synthesis
m.9025G>A (p.G167S)a.G184SDisrupted oligomycin sensitivityATP synthase dysfunction
m.9029A>G (p.H168R)a.H185RAltered mitochondrial membrane potentialSevere ATP deficiency

These studies highlight conserved residues critical for subunit a function .

Clinical Relevance and Pathogenic Variants

Pathogenic mt-atp6 variants often disrupt ATP synthase assembly or proton channel efficiency, leading to:

  • ATP Synthesis Deficits: Reduced ATP production due to impaired proton flow .

  • Mitochondrial Membrane Potential Abnormalities: Increased or decreased membrane potential, reflecting proton leak or channel dysfunction .

For example:

  • m.8993T>G (p.L156R): Linked to NARP syndrome; causes increased membrane potential and oligomycin resistance .

  • m.9185T>C (p.L308P): Associated with Leigh syndrome; reduces ATP hydrolysis and impairs complex assembly .

Key Research Challenges

  1. Heteroplasmy Thresholds: Pathogenic variants require high heteroplasmy (>60–80%) to manifest clinically .

  2. Biochemical Heterogeneity: No universal biomarker exists; ATP synthesis rates, membrane potential, and complex assembly vary across mutations .

  3. Therapeutic Targets: Modulating proton flow or enhancing ATP synthase efficiency remains an active research area .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mt-atp6; atp6; atpase6; mtatp6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis)
Target Names
Target Protein Sequence
MTLSFFDQFLSPTLFGIPLIALALLLPWTLFPAPSSRWVNSRLLTLQSWFINRFTQQLLL PLNMGGHKWGPYILLVMVFLISINMLGLLPYTFTPTTQLSVNMALAVPVWLMTVIIGLRK NPTAALGHLLPEGTPVPLIPALILIETISLFIRPLALGVRLTANLTAGHLLIQLIATAAF VLLPLMPTVAILTTILLFLLTLLEVAVAMIQAYVFVLLLSLYLQENV
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane. This gradient is established by electron transport complexes within the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are connected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis within the catalytic domain of F(1) is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This subunit is a key component of the proton channel and potentially plays a direct role in proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.