Recombinant Tetraodon nigroviridis Cytochrome c oxidase subunit 2 (mt-co2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the available format, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery timelines.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
mt-co2; coii; coxii; mtco2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis)
Target Names
Target Protein Sequence
MAHPSQLGFQDAASPVMEELLHFHDHALMIVFLISTLVLYIIAATASTKLTDKYILDSQE IEVIWTIMPAVILILIALPSLRILYLMDEINDPHLTVKTMGHQWYWSYEYTDYDDLSFDS YMIPTQDLTPGQFRLLETDHRMVIPVDSPIRVLVSAEDVLHSWAVPSLGIKMDAVPGRLN QTAFIVSRPGVFYGQCSEICGANHSFMPIVVEAVPLEHFENWSSLMLEDA
Uniprot No.

Target Background

Function

Recombinant Tetraodon nigroviridis Cytochrome c oxidase subunit 2 (mt-co2) Background:

Cytochrome c oxidase subunit 2 (mt-co2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) composed of heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.

Database Links
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does the function of mt-co2 contribute to the respiratory chain in Tetraodon nigroviridis?

In Tetraodon nigroviridis, mt-co2 functions as an essential component of the cytochrome c oxidase complex (Complex IV), the terminal enzyme of the mitochondrial electron transport chain. This protein contains the primary docking site for cytochrome c and houses a binuclear copper center (CuA) that facilitates electron transfer from cytochrome c to the catalytic core containing the oxygen reduction site.

The protein plays a critical role in:

  • Accepting electrons from reduced cytochrome c

  • Transferring these electrons through the CuA center to other subunits

  • Contributing to the proton-pumping mechanism that generates the electrochemical gradient required for ATP synthesis

  • Supporting the final reduction of molecular oxygen to water

What are the optimal expression and purification conditions for recombinant Tetraodon nigroviridis mt-co2?

Based on established protocols for similar cytochrome c oxidase subunits, the following expression and purification strategy is recommended:

Expression System:

  • Host: E. coli expression systems (BL21(DE3) or similar strains)

  • Vector: pET-series vectors with appropriate tags (His-tag recommended)

  • Induction: 0.5 mM IPTG at lower temperatures (16-25°C) to enhance proper folding

Purification Protocol:

  • Cell lysis using sonication in Tris-based buffer (pH 7.5-8.0) containing protease inhibitors

  • Clarification by centrifugation (15,000 × g, 30 min)

  • Affinity chromatography using Ni-NTA for His-tagged protein

  • Size exclusion chromatography for higher purity

  • Final buffer composition: Tris-based buffer with 50% glycerol for stability

Critical Considerations:

  • Expression at lower temperatures improves proper folding of membrane-associated proteins

  • Addition of detergents (0.1% Triton X-100) may improve solubility

  • Copper supplementation (100 μM CuSO₄) during expression may enhance formation of the CuA center

For optimal activity, the purified protein should be stored at -20°C or -80°C in Tris-based buffer containing 50% glycerol . Avoid repeated freeze-thaw cycles and maintain working aliquots at 4°C for up to one week.

What enzymatic assays can be employed to assess the functional activity of recombinant mt-co2?

Cytochrome c Oxidation Assay:

  • Prepare reaction mixture containing 50 mM phosphate buffer (pH 7.4), 50 μM reduced cytochrome c

  • Add purified recombinant mt-co2 (1-5 μg)

  • Monitor the decrease in absorbance at 550 nm over time, indicating oxidation of cytochrome c

  • Calculate activity using extinction coefficient (ε₅₅₀ = 21.84 mM⁻¹cm⁻¹)

Oxygen Consumption Assay:

  • Using an oxygen electrode (Clark-type) at 25°C

  • Reaction mix: 10 mM HEPES (pH 7.4), 50 mM KCl, 5 mM MgCl₂, 1 mM EDTA

  • Add reduced cytochrome c (50 μM) and purified mt-co2

  • Record oxygen consumption rate

Electron Transfer Kinetics:

  • Stopped-flow spectroscopy to measure rapid electron transfer between reduced cytochrome c and mt-co2

  • Pre-equilibrium kinetics analysis to determine rate constants

  • Various temperatures (10-30°C) to establish thermal profile of activity

Data interpretation should account for temperature dependence of activity, particularly when comparing cold-adapted species like Tetraodon nigroviridis with mesophilic or thermophilic homologs.

What molecular mechanisms drive the evolutionary adaptation of cytochrome c oxidase subunits in fish species from different thermal habitats?

Several molecular mechanisms contribute to thermal adaptation in cytochrome c oxidase subunits across fish species:

  • Amino Acid Substitutions:

    • Polar-to-nonpolar substitutions affect protein flexibility and stability

    • Changes in glycine and proline content modify structural rigidity

    • Surface charge distribution alterations impact protein-protein interactions

  • Post-translational Modifications:

    • Differential phosphorylation patterns regulate activity

    • Altered glycosylation affecting protein stability

  • Transcriptional Regulation:

    • Temperature-specific promoter elements control expression levels

    • Alternative splicing variants optimized for different thermal ranges

  • Protein-Lipid Interactions:

    • Co-evolution with membrane lipid composition

    • Adaptations in transmembrane domains reflecting habitat temperatures

Research comparing transcriptomes of Antarctic fish (like Trematomus bernacchii) with temperate and tropical species (such as Tetraodon nigroviridis) has revealed temperature-specific gene expression patterns . Under thermal stress, cold-adapted species show significant upregulation of cytochrome c oxidase components (2.5-fold increase for COI, 1.5-fold for cytochrome b), which may represent compensatory mechanisms to maintain electron transport capacity at suboptimal temperatures .

How can recombinant mt-co2 be utilized to investigate mitochondrial dysfunction in temperature-dependent disease models?

Recombinant Tetraodon nigroviridis mt-co2 serves as a valuable research tool for investigating temperature-dependent mitochondrial dysfunction through several experimental approaches:

Reconstitution Studies:

  • Incorporate purified recombinant mt-co2 into liposomes or nanodiscs

  • Measure electron transfer rates at various temperatures (0-40°C)

  • Assess functional interactions with cytochrome c and other Complex IV subunits

  • Compare with disease-associated mutant proteins

Thermodynamic Coupling Analysis:

  • Determine the efficiency of energy transduction (electron transfer to proton pumping)

  • Calculate thermodynamic parameters (ΔH, ΔS, ΔG) at different temperatures

  • Assess how temperature affects the coupling between electron transfer and proton translocation

Inhibitor Sensitivity Profiling:

  • Test sensitivity to known Complex IV inhibitors across temperature ranges

  • Compare inhibition kinetics between wild-type and mutant forms

  • Identify temperature-dependent conformational changes affecting inhibitor binding sites

These approaches enable researchers to establish the molecular basis of temperature-dependent mitochondrial dysfunction, with applications to both human disease models and ecological research on climate change impacts.

What techniques can be employed to study the interaction between mt-co2 and other components of the respiratory chain?

Several advanced techniques can elucidate the interactions between mt-co2 and other respiratory chain components:

Protein-Protein Interaction Studies:

  • Surface Plasmon Resonance (SPR):

    • Immobilize recombinant mt-co2 on a sensor chip

    • Flow potential interaction partners (e.g., cytochrome c)

    • Measure binding kinetics at different temperatures

    • Determine association/dissociation constants (ka, kd, KD)

  • Microscale Thermophoresis:

    • Label mt-co2 with fluorescent dye

    • Titrate with binding partners

    • Analyze temperature-dependent mobility changes

    • Calculate binding affinities under various conditions

Structural Analysis:

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Expose protein complexes to D2O

    • Analyze deuterium incorporation patterns

    • Identify interaction interfaces and conformational changes

    • Compare temperature effects on protein dynamics

  • Cryo-EM Analysis:

    • Visualize mt-co2 within the Complete Complex IV structure

    • Identify temperature-dependent conformational states

    • Map electron transfer pathways through the complex

These techniques provide complementary information about the structural and functional interactions between mt-co2 and its partners in the respiratory chain, offering insights into how these interactions may be affected by temperature changes.

How can recombinant mt-co2 be employed in studies of adaptive responses to climate change in aquatic ecosystems?

Recombinant Tetraodon nigroviridis mt-co2 provides a valuable model system for investigating metabolic adaptation to changing temperatures in aquatic ecosystems:

Comparative Enzymatic Profiling:

  • Compare enzymatic parameters (kcat, Km) of mt-co2 from species across thermal gradients

  • Assess temperature dependence of activity (Q10 coefficients)

  • Determine activation energies (Ea) for the electron transfer reaction

  • Construct thermal performance curves to predict climate change impacts

Temperature Acclimation Studies:

  • Analyze expression patterns of native mt-co2 in fish acclimated to different temperatures

  • Compare with homologs from other species with different thermal histories

  • Identify compensatory modifications in protein structure or abundance

Functional Substitution Experiments:

  • Generate chimeric proteins containing domains from cold-adapted and warm-adapted species

  • Determine which regions confer thermal sensitivity or resilience

  • Create predictive models for evolutionary adaptation under warming scenarios

In Trematomus bernacchii, thermal stress (+4°C exposure) induced significant upregulation of cytochrome c oxidase I (2.5-fold) and cytochrome b (1.5-fold), suggesting that respiratory chain components play a key role in metabolic compensation during temperature changes . Similar studies using Tetraodon nigroviridis can provide insights into adaptation mechanisms in warm-water species facing further warming under climate change scenarios.

What methodological approaches can be used to investigate post-translational modifications of mt-co2 and their impact on protein function?

Post-translational modifications (PTMs) of mt-co2 can significantly impact its function and are critical to understanding its regulation under different physiological conditions:

Identification of PTMs:

  • Mass Spectrometry-Based Approaches:

    • Tryptic digest of purified mt-co2

    • LC-MS/MS analysis with CID/ETD fragmentation

    • Database search with variable modifications

    • Site-specific localization and quantification

  • Phosphoproteomics:

    • TiO2 enrichment of phosphorylated peptides

    • Parallel reaction monitoring (PRM) for targeted quantification

    • Comparison of phosphorylation patterns under different thermal conditions

Functional Analysis of PTMs:

  • Site-Directed Mutagenesis:

    • Generate phospho-mimetic (S/T→D/E) and phospho-null (S/T→A) mutants

    • Assess impact on electron transfer activity

    • Determine effects on protein-protein interactions

    • Evaluate thermal stability of modified proteins

  • In vitro Modification Systems:

    • Recombinant kinases/phosphatases to modify purified mt-co2

    • Monitor real-time changes in activity following modification

    • Identify regulatory kinases/phosphatases in temperature response

These methodologies enable researchers to establish the regulatory role of PTMs in mt-co2 function and their potential involvement in thermal adaptation mechanisms, providing insights into both evolutionary biology and potential biomedical applications.

What are the common challenges in expressing and purifying functional recombinant mt-co2, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant mt-co2:

Challenge 1: Low Solubility and Inclusion Body Formation

  • Solution: Optimize expression conditions using lower temperatures (16-18°C), reduced IPTG concentration (0.1-0.2 mM), and specialized E. coli strains (Rosetta, Arctic Express)

  • Alternative Approach: Inclusion body solubilization using 8M urea followed by on-column refolding during purification

  • Detergent Screening: Systematic testing of detergents (DDM, CHAPS, Triton X-100) to improve solubility

Challenge 2: Insufficient Copper Incorporation

  • Solution: Supplement expression media with 100-200 μM CuSO₄

  • Alternative Approach: In vitro reconstitution of the CuA center post-purification

  • Verification Method: UV-Vis spectroscopy to confirm copper incorporation (characteristic absorption at ~480 nm)

Challenge 3: Loss of Activity During Purification

  • Solution: Include stabilizing agents (glycerol, reducing agents) in all buffers

  • Storage Recommendation: Store in Tris-based buffer with 50% glycerol at -20°C/-80°C

  • Aliquoting Strategy: Prepare single-use aliquots to avoid freeze-thaw cycles

Challenge 4: Heterogeneous Product

  • Solution: Implement multi-step purification (IMAC followed by size exclusion chromatography)

  • Quality Control: SDS-PAGE with western blot confirmation using anti-His and mt-co2-specific antibodies

  • Mass Spectrometry: Verify protein integrity and identify potential truncations or modifications

Troubleshooting experiments should be conducted systematically, changing one variable at a time and documenting outcomes carefully to identify optimal conditions for your specific construct.

How do buffer conditions and storage parameters affect the stability and activity of recombinant mt-co2?

Buffer composition and storage conditions significantly impact the stability and activity of recombinant mt-co2:

Buffer Composition Effects:

ComponentOptimal RangeEffect on Stability/ActivityRecommendation
pH7.5-8.0Higher pH (>8.5) reduces CuA stabilityUse Tris or HEPES buffers at pH 7.8
Ionic Strength50-150 mM NaClHigher salt (>200 mM) may disrupt electrostatic interactionsInclude 100 mM NaCl for optimal stability
Glycerol20-50%Prevents freeze-thaw damageStore with 50% glycerol at -20°C
Reducing Agents1-5 mM DTT/BMEPrevents oxidative damageInclude 2 mM DTT in working solutions
Metal Chelators0.1-1 mM EDTAPrevents metal-catalyzed oxidationLow EDTA (0.1 mM) is beneficial; higher concentrations may remove copper

Storage Parameters:

  • Temperature Effects:

    • -80°C: Longest-term stability (>6 months)

    • -20°C: Good stability with 50% glycerol (2-3 months)

    • 4°C: Limited stability (≤1 week) for working solutions

    • Room temperature: Rapid activity loss (hours)

  • Freeze-Thaw Impact:

    • Each freeze-thaw cycle typically results in 10-15% activity loss

    • Limit to ≤3 cycles by preparing appropriately sized aliquots

    • Flash-freezing in liquid nitrogen before -80°C storage improves preservation

  • Container Considerations:

    • Low-binding microcentrifuge tubes reduce protein adsorption

    • Dark or amber containers minimize photo-oxidation

    • Completely fill containers to minimize air exposure

For optimal results, store the concentrated stock solution (>1 mg/mL) in small aliquots with 50% glycerol at -20°C or -80°C, and prepare fresh working solutions from these stocks as needed .

What emerging technologies could advance our understanding of mt-co2 function in complex biological systems?

Several cutting-edge technologies show promise for deepening our understanding of mt-co2 function:

Single-Molecule Techniques:

  • Single-Molecule FRET:

    • Real-time visualization of conformational changes during electron transfer

    • Tracking of mt-co2 interactions with cytochrome c at the single-molecule level

    • Temperature-dependent dynamics of protein motion

  • Nanoscale Respirometry:

    • Single-complex activity measurements using nanofabricated electrodes

    • Direct correlation between structure and function at individual complex level

    • Detection of rare or transient functional states

Advanced Imaging Applications:

  • Cryo-Electron Tomography:

    • Visualizing mt-co2 within intact mitochondrial membranes

    • Structural organization in different tissues and physiological states

    • Comparative analysis across species with different thermal adaptations

  • Super-Resolution Microscopy:

    • Nanoscale organization of respiratory complexes in mitochondria

    • Dynamic assembly/disassembly of supercomplexes under thermal stress

    • Integration of functional readouts (e.g., membrane potential sensors)

Computational Approaches:

  • Molecular Dynamics Simulations:

    • Temperature-dependent conformational changes in mt-co2

    • Simulation of electron transfer pathways at different temperatures

    • Prediction of stability-enhancing mutations for biotechnological applications

  • Machine Learning Integration:

    • Pattern recognition in sequence-function relationships across species

    • Prediction of thermal adaptation mechanisms from primary sequence

    • Automated design of optimized mt-co2 variants for specific applications

These emerging technologies will enable more precise and comprehensive understanding of mt-co2 function in complex biological contexts, potentially leading to biotechnological applications in bioenergetics and environmental adaptation research.

How might studies of mt-co2 contribute to understanding the mechanisms of thermal adaptation in changing aquatic ecosystems?

Research on mt-co2 can significantly advance our understanding of thermal adaptation mechanisms through several research directions:

Comprehensive Comparative Genomics:

  • Sequence analysis of mt-co2 across species spanning thermal gradients (polar to tropical)

  • Identification of convergent adaptations in unrelated species from similar thermal niches

  • Correlation of sequence variations with habitat temperature profiles

Integrated Physiological Approaches:

  • Linking mt-co2 modifications to whole-organism metabolic performance

  • Measuring thermal performance curves for respiratory function across development

  • Assessing the role of mt-co2 in setting thermal tolerance limits

Climate Change Response Prediction:

  • Experimental evolution studies under simulated warming scenarios

  • Identification of genetic markers for thermal adaptation potential

  • Development of predictive models for population-level responses

Research on Trematomus bernacchii demonstrated a 2.5-fold upregulation of cytochrome c oxidase I and a 1.5-fold upregulation of cytochrome b under thermal stress (+4°C) , suggesting that respiratory chain components play a key role in metabolic compensation during temperature changes. Similar studies across species with different evolutionary histories can reveal both shared and distinct mechanisms of thermal adaptation.

This research has significant implications for predicting population-level responses to climate change, potentially identifying species or populations with greater adaptive capacity and those at higher risk from warming temperatures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.