Recombinant Tetraodon nigroviridis FUN14 domain-containing protein 1 (fundc1)

Shipped with Ice Packs
In Stock

Description

Production and Purity

Recombinant fundc1 is synthesized in diverse host systems to optimize yield and folding:

Host SystemPurityApplicationsSource
E. coli≥85% (SDS-PAGE)High-throughput biochemical assays (e.g., kinase studies)
Yeast≥85%Post-translational modification studies
Baculovirus≥85%Structural studies (e.g., X-ray crystallography)
Mammalian cells≥85%Functional assays (e.g., mitophagy induction)

Key considerations include:

  • Tagging: Some variants include AviTag for biotinylation or other affinity tags .

  • Storage: -20°C or -80°C to maintain stability .

Mitophagy Regulation

  • LC3 interaction: The LIR motif enables binding to LC3 during hypoxia, mimicking human FUNDC1’s role in mitophagy .

  • Phosphorylation dynamics: Recombinant fundc1 can be used to study ULK1-mediated Ser17 phosphorylation or PGAM5-dependent dephosphorylation of Ser13/Tyr18 .

Mitochondrial Dynamics

  • DRP1/OPA1 interactions: Recombinant fundc1 may recruit DRP1 (fission) or OPA1 (fusion) under stress, as observed in human models .

  • ER-mitochondria contact: Co-localization with calnexin at ER-mitochondria contact sites could be reconstituted in vitro .

Evolutionary Studies

  • Cross-species comparisons: Recombinant fundc1 enables analysis of conserved or divergent mitophagy pathways between Tetraodon and mammals .

Comparative Analysis with Other Species

Recombinant fundc1 shares functional similarities with human FUNDC1 but differs in expression systems and applications:

SpeciesRecombinant HostKey ApplicationsSource
Tetraodon nigroviridisE. coli, Yeast, BaculovirusEvolutionary mitophagy studies, kinase assays
Homo sapiensE. coli, Mammalian cellsCancer, neurodegeneration, and cardiovascular research
Mus musculusCell-free expressionMurine mitophagy models

Challenges and Future Directions

  • Limited functional data: Most studies focus on human/mammalian FUNDC1; Tetraodon fundc1 requires validation in mitophagy assays.

  • Post-translational modifications: Recombinant proteins may lack native phosphorylation patterns, necessitating in vitro reconstitution .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
fundc1; GSTENG00027182001; FUN14 domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis)
Target Names
Target Protein Sequence
MATVDHREAGQDDPESEDEVYEVVDLTEYARRHQWWSRVFGSNSGPIAEKYSVTTQLVMG GLTGWCAGYLFQRVGKIAATAVGGGFLLLQIANHSGYVQVDWKKVEKDVNKAKKRLKKKA NKAVPEINTLIEEATDFIKKNIVLSGGFVGGFLLGLAS
Uniprot No.

Target Background

Function
Activates hypoxia-induced mitophagy, a crucial mechanism for mitochondrial quality control.
Database Links
Protein Families
FUN14 family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.

Q&A

What is FUNDC1 and why is the Tetraodon nigroviridis ortholog significant for research?

FUNDC1 (FUN14 domain-containing protein 1) is a mitophagy receptor protein located in the outer mitochondrial membrane that plays a critical role in the selective elimination of dysfunctional mitochondria. The Tetraodon nigroviridis (spotted green pufferfish) ortholog is significant because this species serves as an important model organism in evolutionary and comparative genomic studies. The pufferfish genome is highly compact, making it valuable for identifying conserved functional elements across vertebrates . The recombinant form allows researchers to study the evolutionary conservation of mitophagy mechanisms across species and to use it as a tool for understanding fundamental mitochondrial quality control processes.

How does Tetraodon nigroviridis FUNDC1 compare to mammalian orthologs?

While the full comparative analysis between Tetraodon nigroviridis FUNDC1 and mammalian orthologs isn't detailed in the search results, we can infer some key points:

  • Conservation of core domains: The FUN14 domain is conserved across species, suggesting functional importance in mitophagy processes.

  • Evolutionary distance: Phylogenetic studies show that Tetraodon nigroviridis diverged from other model fish organisms at different time points: approximately 85 million years ago (MYA) from torafugu, 183 MYA from three-spined stickleback, 191 MYA from medaka, and 324 MYA from zebrafish .

  • Functional domains: Like its mammalian counterparts, the pufferfish FUNDC1 likely contains key phosphorylation sites that regulate its activity, though these may have species-specific variations.

What are the primary molecular functions of FUNDC1 in mitophagy regulation?

FUNDC1 functions as a mitophagy receptor primarily through the following mechanisms:

  • Phosphorylation-dependent regulation: FUNDC1 activity is regulated by reversible phosphorylation. Under normal conditions, Ser13 is phosphorylated by CK2 kinase and Tyr18 is phosphorylated by SRC kinase, inhibiting interaction with LC3 and preventing mitophagy. Under hypoxic conditions or stress, dephosphorylation of these sites enhances FUNDC1-LC3 interaction, triggering mitophagy .

  • ULK1 interaction: FUNDC1 serves as a mitochondrial substrate for ULK1, which phosphorylates FUNDC1 at Ser17. This phosphorylation promotes mitophagy, contrary to the inhibitory effects of phosphorylation at Ser13 and Tyr18. The ULK1-FUNDC1 interaction is crucial for mitophagy regulation under stress conditions .

  • LC3 binding: Upon activation, FUNDC1 directly binds to the autophagosomal protein LC3 through its LIR (LC3-interacting region) motif, facilitating the engulfment of damaged mitochondria by autophagosomes .

These molecular mechanisms allow FUNDC1 to serve as a critical switch for mitophagy initiation, particularly under hypoxic conditions.

Beyond mitophagy, what other cellular processes does FUNDC1 regulate?

FUNDC1 has been implicated in several processes beyond its canonical role in mitophagy:

  • Mitochondria-ER membrane contact sites: FUNDC1 localizes to mitochondria-associated endoplasmic reticulum membranes (MAMs) and regulates their formation through interaction with inositol 1,4,5-trisphosphate receptors (IP3Rs) .

  • Calcium homeostasis: Through its role at MAMs, FUNDC1 influences Ca²⁺ transfer between ER and mitochondria, affecting mitochondrial metabolism and cell death pathways .

  • Mitochondrial dynamics: FUNDC1 participates in the regulation of mitochondrial fission and fusion. It can promote mitochondrial fission by upregulating expression of fission proteins like Fis1 through a CREB-dependent pathway .

  • Protein quality control: FUNDC1 interacts with the mitochondrial protease LonP1 and helps maintain proper folding of mitochondrial complex V subunits, thus preserving oxidative phosphorylation activity .

  • Cell motility and invasion: FUNDC1 suppresses tumor cell motility by stabilizing mitochondrial complex V and reducing ROS production. Loss of FUNDC1 promotes focal adhesion dynamics and enhances cancer cell migration and invasion .

How does FUNDC1 contribute to the PGC-1α/NRF1 regulatory axis in mitochondrial biogenesis?

FUNDC1 plays a crucial role in coupling mitophagy with mitochondrial biogenesis through the PGC-1α/NRF1 pathway:

  • Transcriptional regulation: The FUNDC1 gene promoter contains NRF1 binding sites. PGC-1α and NRF1 co-bind to this promoter region, directly regulating FUNDC1 expression .

  • Feedback mechanism: While PGC-1α/NRF1 upregulates FUNDC1 expression to enhance mitophagy, FUNDC1-mediated mitophagy helps remove damaged mitochondria, making room for newly synthesized mitochondria through PGC-1α-driven biogenesis.

  • Adaptive thermogenesis: In brown adipose tissue, this coordinated regulation of mitophagy and biogenesis via FUNDC1 contributes to adaptive thermogenesis. Knockout of FUNDC1 in brown adipose tissue results in reduced mitochondrial turnover and impaired adaptive thermogenesis .

This regulatory axis demonstrates how FUNDC1 helps maintain mitochondrial quality control by balancing removal of damaged mitochondria with the generation of new, functional ones.

What are the optimal conditions for expressing and purifying recombinant Tetraodon nigroviridis FUNDC1?

Based on available information, the following protocol is recommended for expression and purification of recombinant Tetraodon nigroviridis FUNDC1:

Expression system:

  • In vitro E. coli expression system is commonly used

  • The full-length protein (amino acids 1-158) with an N-terminal 10xHis tag

Buffer conditions:

  • The purified protein is typically prepared in Tris/PBS-based buffer, pH 8.0

  • For storage, 6% trehalose is often added as a stabilizer

Purification procedure:

  • Transform expression vector into appropriate E. coli strain

  • Induce protein expression with IPTG

  • Harvest cells and lyse using appropriate buffer

  • Purify using Ni-NTA affinity chromatography, leveraging the His-tag

  • Further purify using size exclusion chromatography if higher purity is required

Storage recommendations:

  • Store at -20°C/-80°C upon receipt

  • Aliquot for multiple use to avoid repeated freeze-thaw cycles

  • Lyophilized form has a shelf life of approximately 12 months at -20°C/-80°C

  • Liquid form has a shelf life of approximately 6 months at -20°C/-80°C

What experimental techniques are most effective for studying FUNDC1-mediated mitophagy in vitro?

Several experimental approaches have proven effective for studying FUNDC1-mediated mitophagy:

  • Gene knockdown/knockout methods:

    • siRNA or shRNA for transient knockdown

    • CRISPR/Cas9 for generating stable knockout cell lines

    • Tissue-specific knockout animal models (e.g., hepatocyte-specific FUNDC1 knockout mice)

  • Protein-protein interaction assays:

    • Co-immunoprecipitation to study FUNDC1 interactions with LC3, ULK1, or other partners

    • GST pulldown assays to validate direct interactions

    • Proximity ligation assays to visualize interactions in situ

  • Phosphorylation analysis:

    • Phospho-specific antibodies to monitor Ser13, Ser17, and Tyr18 phosphorylation states

    • In vitro kinase assays to study CK2, SRC, or ULK1-mediated phosphorylation

    • Phosphomimetic or phospho-deficient mutants (e.g., S13A, Y18A) to study functional effects

  • Mitophagy detection methods:

    • Fluorescence microscopy using mitochondrial markers (MitoTracker) and autophagosome markers (LC3)

    • Transmission electron microscopy to visualize mitochondria within autophagosomes

    • Biochemical assays measuring mitochondrial protein degradation

    • mtKeima assay for quantitative assessment of mitophagy flux

  • Functional readouts:

    • Measurement of mitochondrial membrane potential using TMRM or JC-1

    • Mitochondrial respiration assays using Seahorse Analyzer

    • ATP production measurement

    • ROS detection using specific fluorescent probes

How can researchers design experiments to investigate the interaction between FUNDC1 and the mitochondrial complex V?

To investigate FUNDC1 and mitochondrial complex V interactions, researchers could implement the following experimental design:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation of FUNDC1 with complex V subunits (ATP5C1, ATP5O, ATP5B)

    • Proximity ligation assays to visualize and quantify interactions in situ

    • Molecular mapping using deletion constructs to identify specific interaction domains

  • Complex V activity assays:

    • Measure complex V activity in FUNDC1 knockout/knockdown cells compared to controls

    • Normalize complex V activity to citrate synthase activity to account for differences in mitochondrial content

    • Perform reconstitution experiments with recombinant FUNDC1 to demonstrate rescue of complex V activity

  • Protein stability and folding analysis:

    • Cycloheximide chase experiments to assess degradation rates of complex V subunits in FUNDC1-depleted cells

    • Proteinase K sensitivity assays to evaluate protein folding

    • Differential detergent solubility to assess aggregation of complex V subunits

  • Functional consequences:

    • Measure ATP production in FUNDC1-manipulated cells

    • Assess mitochondrial membrane potential

    • Evaluate oxidative stress levels and ROS production

    • Analyze mitochondrial respiration using Seahorse XF Analyzer

TechniqueApplicationAdvantagesLimitations
Co-immunoprecipitationDetect physical interactionCan be performed with endogenous proteinsMay detect indirect interactions
Proximity ligation assayVisualize interactions in situSingle-molecule resolution, preserves cellular contextRequires highly specific antibodies
Complex V activity assayFunctional assessmentDirect measure of functional impactRequires isolated mitochondria
Cycloheximide chaseProtein stabilityTracks degradation kineticsAffects all protein synthesis
Seahorse respiration analysisBioenergetic impactReal-time measurement of respiratory functionExpensive equipment required

How does FUNDC1 function differ under normoxic versus hypoxic conditions?

FUNDC1's function undergoes significant changes between normoxic and hypoxic conditions:

Under normoxic conditions:

  • FUNDC1 is maintained in an inhibited state through phosphorylation at Ser13 by CK2 and Tyr18 by SRC kinase.

  • These phosphorylations prevent FUNDC1 from interacting with LC3, thus keeping mitophagy at basal levels.

  • FUNDC1 participates in maintaining normal mitochondrial dynamics and quality control.

  • It contributes to mitochondria-ER contact sites (MAMs) and calcium homeostasis .

Under hypoxic conditions:

  • Hypoxia leads to dephosphorylation of FUNDC1 at Ser13 and Tyr18, enhancing its interaction with LC3.

  • ULK1 is recruited to mitochondria where it phosphorylates FUNDC1 at Ser17, further promoting mitophagy.

  • Activated FUNDC1 accelerates the clearance of damaged mitochondria to protect cells from oxidative stress.

  • In some contexts, FUNDC1 expression itself may be upregulated under hypoxia .

This oxygen-sensitive regulation allows FUNDC1 to serve as a critical sensor that triggers protective mitophagy in response to hypoxic stress, removing damaged mitochondria that might otherwise produce harmful ROS.

What contradictory findings exist regarding FUNDC1's role in cancer progression?

The research on FUNDC1's role in cancer reveals some intriguing contradictions:

Anti-tumor effects:

  • In hepatocellular carcinoma (HCC), FUNDC1-mediated mitophagy suppresses tumor initiation by reducing inflammasome activation and inflammatory responses in hepatocytes.

  • Knockout of FUNDC1 in hepatocytes promotes the initiation and progression of chemically-induced HCC.

  • FUNDC1 transgenic hepatocytes show protection against HCC development .

Pro-tumor effects:

  • FUNDC1 accumulates in most human HCCs, suggesting potential pro-tumor roles in established cancers.

  • Up-regulation of FUNDC1 at late stages of tumor development may benefit tumor growth.

  • In some contexts, FUNDC1 may promote adaptation to the hypoxic tumor microenvironment .

Dual roles in metastasis:

These contradictions suggest that FUNDC1's role in cancer may be stage-dependent and context-specific, with different effects during tumor initiation versus progression, and varying impacts depending on cancer type and microenvironment conditions.

How can researchers design experiments to resolve conflicting data on FUNDC1's role in disease models?

To address contradictions in FUNDC1 research, investigators should consider these experimental approaches:

  • Stage-specific analysis:

    • Use inducible knockout/knockin systems to manipulate FUNDC1 at different disease stages

    • Employ time-course studies to track FUNDC1 function throughout disease progression

    • Compare early vs. late effects in the same model systems

  • Context-dependent studies:

    • Examine FUNDC1 function under various microenvironmental conditions (normoxia vs. hypoxia, inflammatory vs. non-inflammatory)

    • Use co-culture systems to assess cell-cell interaction effects on FUNDC1 function

    • Study FUNDC1 in different cell types within the same tissue/organ

  • Comprehensive phenotyping:

    • Analyze multiple endpoints simultaneously (proliferation, invasion, metabolism, inflammation)

    • Employ multi-omics approaches (transcriptomics, proteomics, metabolomics)

    • Use in vivo imaging to track disease progression in real-time

  • Mechanistic dissection:

    • Generate phosphorylation-specific FUNDC1 mutants to separate different functions

    • Create domain-specific knockins to isolate particular protein-protein interactions

    • Use proximity labeling techniques (BioID, APEX) to identify context-specific interaction partners

  • Integrated analysis framework:

Table 2: Framework for resolving FUNDC1 functional contradictions

Experimental LayerTechniquesExpected Outcome
Temporal dynamicsTime-course analysis, inducible systemsIdentify stage-specific functions
Spatial contextTissue-specific knockouts, in situ analysisMap location-dependent roles
Molecular mechanismMutational analysis, interaction studiesSeparate different functional pathways
Physiological impactMulti-parametric phenotypingDistinguish primary vs. secondary effects
Clinical correlationPatient sample analysis, biomarker studiesEstablish relevance to human disease

By implementing this systematic approach, researchers can better understand how FUNDC1's functions may differ across contexts, potentially reconciling seemingly contradictory findings.

What are the critical knowledge gaps in understanding Tetraodon nigroviridis FUNDC1 compared to mammalian orthologs?

Several knowledge gaps exist that warrant further investigation:

  • Structural comparison: Detailed structural analysis comparing pufferfish FUNDC1 with mammalian orthologs is lacking. This is crucial for understanding evolutionary conservation of functional domains and potential species-specific adaptations.

  • Phosphorylation sites: The conservation and functional significance of key regulatory phosphorylation sites (Ser13, Ser17, Tyr18) in Tetraodon nigroviridis FUNDC1 remain uncharacterized.

  • Interactome differences: The protein-protein interaction network of pufferfish FUNDC1 has not been systematically compared with that of mammalian FUNDC1, leaving questions about conservation of mitophagy mechanisms.

  • Environmental adaptation: Given the aquatic environment of Tetraodon nigroviridis, potential adaptations in FUNDC1 function related to hypoxia response, temperature sensitivity, or other environmental factors remain unexplored.

  • Tissue-specific expression: Comprehensive analysis of FUNDC1 expression patterns across tissues in Tetraodon nigroviridis would help understand potential functional specialization compared to mammals.

Addressing these gaps would significantly enhance our understanding of evolutionary conservation in mitophagy mechanisms and potentially reveal novel aspects of FUNDC1 biology.

How might emerging technologies advance our understanding of FUNDC1-mediated mitochondrial quality control?

Emerging technologies offer promising avenues for FUNDC1 research:

  • Cryo-electron microscopy (Cryo-EM): Could reveal the detailed structure of FUNDC1 in association with LC3 and other partners, providing insights into the molecular mechanisms of mitophagy initiation.

  • CRISPR base editing and prime editing: Allow precise modification of FUNDC1 regulatory sites without introducing double-strand breaks, enabling nuanced studies of phosphorylation site functions.

  • Live-cell mitophagy sensors: New fluorescent reporters that specifically track mitophagy events would allow real-time monitoring of FUNDC1 activity in various conditions.

  • Single-cell multi-omics: Combined transcriptomic, proteomic, and metabolomic analysis at single-cell resolution could reveal cell-to-cell variability in FUNDC1 function and mitochondrial quality control.

  • Organoid models: More physiologically relevant than traditional cell culture, organoids could help study FUNDC1 function in complex tissue contexts.

  • Optical tweezers and force spectroscopy: Could measure the binding kinetics and forces involved in FUNDC1-LC3 interactions under different phosphorylation states.

  • Mitochondrial-targeted mass spectrometry: Would allow precise quantification of mitochondrial proteome changes in response to FUNDC1 manipulation.

  • In situ cryo-electron tomography: Could visualize the structural changes in mitochondria-autophagosome contacts during FUNDC1-mediated mitophagy.

These technologies promise to reveal new insights into the spatial, temporal, and molecular aspects of FUNDC1 function in mitochondrial quality control.

What interdisciplinary approaches could yield novel insights into the evolutionary conservation of FUNDC1 functions?

Interdisciplinary approaches that could advance FUNDC1 research include:

  • Comparative genomics and phylogenetics:

    • Systematic analysis of FUNDC1 across diverse vertebrate species

    • Identification of conserved regulatory elements in FUNDC1 gene promoters

    • Correlation of FUNDC1 sequence divergence with environmental adaptations

  • Evolutionary biochemistry:

    • Reconstruction of ancestral FUNDC1 proteins

    • Functional testing of FUNDC1 from species adapted to different oxygen environments

    • Assessment of phosphorylation kinetics across evolutionarily diverse FUNDC1 orthologs

  • Ecological physiology:

    • Study of FUNDC1 function in species with unique metabolic adaptations

    • Analysis of FUNDC1 regulation in hibernating animals or those adapted to hypoxic niches

    • Comparison of FUNDC1 activity in related species with different activity patterns

  • Systems biology and network analysis:

    • Computational modeling of FUNDC1 regulatory networks across species

    • Network comparison to identify conserved vs. species-specific interactions

    • Integration of multi-omics data to build predictive models of FUNDC1 function

  • Synthetic biology approaches:

    • Creation of chimeric FUNDC1 proteins with domains from different species

    • Engineering of minimal synthetic FUNDC1 systems to test functional hypotheses

    • Development of optogenetic FUNDC1 variants for precise spatiotemporal control

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.