Recombinant Tetraodon nigroviridis NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Introduction to Tetraodon nigroviridis and MT-ND3

Tetraodon nigroviridis, commonly known as the spotted green pufferfish, is a small marine teleost fish that has gained significant attention in scientific research due to its compact genome and unique biological properties. The fish serves as an important model organism for comparative genomics, evolutionary studies, and investigations into mitochondrial function. MT-ND3 is one of the essential components of the mitochondrial respiratory chain, specifically Complex I (NADH:ubiquinone oxidoreductase). This protein plays a crucial role in electron transport and oxidative phosphorylation, processes fundamental to cellular energy production.

Taxonomic Classification

Tetraodon nigroviridis belongs to the following taxonomic hierarchy:

  • Kingdom: Animalia

  • Phylum: Chordata

  • Class: Actinopterygii

  • Order: Tetraodontiformes

  • Family: Tetraodontidae

  • Genus: Tetraodon

  • Species: T. nigroviridis

Biological Significance

The study of mitochondrial proteins from T. nigroviridis has become increasingly important for understanding evolutionary relationships among vertebrates and investigating mechanisms of resistance to pathogenic infections. Recent multi-omics research has revealed that T. nigroviridis possesses distinctive immune responses to exogenous infections, with mitochondrial proteins potentially playing important roles in these defense mechanisms . The compact genome of T. nigroviridis makes it an excellent model for studying gene function and regulation, including mitochondrial genes such as MT-ND3.

Protein Structure and Composition

MT-ND3 is a hydrophobic membrane protein encoded by the mitochondrial genome. Based on comparative analysis with related mitochondrial proteins from T. nigroviridis, we can infer several structural characteristics. While specific sequence data for MT-ND3 is not provided in the search results, related mitochondrial proteins such as MT-ND6 provide valuable insights into the probable structure of MT-ND3.

Amino Acid Sequence and Domains

Although the specific amino acid sequence for MT-ND3 is not available in the search results, we can examine the characteristics of related mitochondrial proteins. For example, MT-ND6 from T. nigroviridis consists of 173 amino acids with a sequence characterized by hydrophobic regions typical of membrane-embedded proteins . Similarly, MT-ND3 likely contains multiple transmembrane domains and hydrophobic regions that facilitate its integration into the inner mitochondrial membrane.

Comparative Analysis with Other Species

The structural features of MT-ND3 are likely conserved across various species due to the essential nature of mitochondrial respiratory proteins. While specific comparative data for MT-ND3 is not available in the search results, the high conservation of mitochondrial proteins across species suggests that T. nigroviridis MT-ND3 shares significant homology with its counterparts in other vertebrates.

Expression Systems

Recombinant MT-ND3 protein from T. nigroviridis can be produced using methodologies similar to those employed for other mitochondrial proteins from this species. Based on the information available for related proteins, Escherichia coli (E. coli) appears to be the preferred expression system for recombinant production of T. nigroviridis mitochondrial proteins . The bacterial expression system offers advantages in terms of scalability, cost-effectiveness, and well-established protocols for protein purification.

Purification Methods

The purification of recombinant MT-ND3 would likely follow similar protocols to those used for other T. nigroviridis mitochondrial proteins. These typically involve:

  1. Bacterial cell lysis

  2. Affinity chromatography (utilizing His-tags)

  3. Size exclusion chromatography

  4. Quality assessment using SDS-PAGE

Protein Tags and Fusion Partners

Based on information about related proteins, recombinant MT-ND3 would likely be produced with an N-terminal histidine (His) tag to facilitate purification . This approach allows for efficient isolation of the target protein using nickel affinity chromatography. The recombinant product would likely be referred to as "Recombinant Full Length Tetraodon nigroviridis NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) Protein, His-Tagged."

Role in Mitochondrial Complex I

MT-ND3 is an integral component of Complex I (NADH:ubiquinone oxidoreductase) in the mitochondrial respiratory chain. Its primary function involves the transfer of electrons from NADH to ubiquinone, which constitutes the first step in the electron transport chain. This process is fundamental to oxidative phosphorylation and ATP production.

Electron Transport Mechanisms

The electron transport function of MT-ND3 contributes to the generation of a proton gradient across the inner mitochondrial membrane. This electrochemical gradient drives ATP synthesis, providing the energy necessary for cellular functions. MT-ND3 likely contains critical residues that facilitate electron transfer and contribute to the proton-pumping mechanism of Complex I.

Interaction with Other Mitochondrial Proteins

MT-ND3 interacts with multiple protein subunits within Complex I, including other MT-ND proteins. While specific interaction data for T. nigroviridis MT-ND3 is not available in the search results, this protein likely forms part of a larger assembly within the inner mitochondrial membrane, cooperating with other subunits to maintain the structural integrity and functional efficiency of Complex I.

Studies on Mitochondrial Function

Recombinant MT-ND3 protein serves as a valuable tool for investigating mitochondrial function, particularly in the context of energy metabolism and respiratory chain activity. Researchers can utilize purified MT-ND3 to study:

  • Structure-function relationships in Complex I

  • Electron transfer mechanisms

  • Mitochondrial disorders associated with Complex I dysfunction

Evolutionary and Comparative Studies

T. nigroviridis MT-ND3 offers significant potential for evolutionary and comparative studies. The compact genome of this species, combined with the conserved nature of mitochondrial proteins, makes MT-ND3 a suitable candidate for investigating evolutionary relationships among vertebrates and the adaptation of respiratory chain components across different taxonomic groups.

Immunological Research

Recent research on T. nigroviridis has highlighted its unique immune responses to exogenous infections . While not specifically mentioned in relation to MT-ND3, mitochondrial proteins may play roles in cellular responses to pathogens. Recombinant MT-ND3 could potentially be employed in studies investigating the intersection of mitochondrial function and immune responses in this species.

Reconstitution Protocols

The reconstitution of lyophilized MT-ND3 would likely follow protocols similar to those for other T. nigroviridis recombinant proteins. This typically involves:

  1. Brief centrifugation of the vial prior to opening

  2. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Addition of 5-50% glycerol (final concentration) for long-term storage

Buffer Compositions

Based on similar recombinant proteins, MT-ND3 would likely be stored in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . This buffer composition helps maintain protein stability during storage and prevents degradation.

Product Information

Table 1: Projected Product Specifications for Recombinant T. nigroviridis MT-ND3

ParameterSpecification
SpeciesTetraodon nigroviridis (Spotted green pufferfish)
SourceE. coli
TagHis
FormLyophilized powder
Purity>90% as determined by SDS-PAGE
Storage-20°C/-80°C, avoid freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

Quality Control Measures

Quality control for recombinant MT-ND3 would likely include:

  1. SDS-PAGE analysis to verify purity (>90%)

  2. Mass spectrometry to confirm protein identity

  3. Functional assays to assess biological activity

Structure-Function Analysis

Future research on T. nigroviridis MT-ND3 may focus on detailed structure-function analysis, potentially involving:

  • X-ray crystallography or cryo-electron microscopy to determine the three-dimensional structure

  • Site-directed mutagenesis to identify critical functional residues

  • Protein-protein interaction studies to map the binding interfaces within Complex I

Comparative Genomics and Evolution

The evolutionary significance of MT-ND3 in T. nigroviridis represents an important area for future investigation. Comparative analysis with MT-ND3 from other species may reveal adaptive changes related to different environmental conditions and metabolic requirements.

Role in Disease Models

Given the involvement of Complex I in various mitochondrial disorders, recombinant T. nigroviridis MT-ND3 could potentially serve as a model for studying disease-associated mutations and their effects on protein function and stability.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis)
Target Names
Target Protein Sequence
MNLLLTILFITTILSLILAIVSFWLPLMTPDYQKLSPYECGFDPLGSARLPFSIRFFLVA ILFLLFDLEIALLLPLPWGDQLPSPMFTLLWASALLIMLTLGLIYEWLQGGLEWAEK
Uniprot No.

Target Background

Function

Recombinant Tetraodon nigroviridis NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

MT-ND3 is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what is its fundamental role in mitochondrial function?

MT-ND3, or mitochondrially encoded NADH dehydrogenase 3, is an essential component of the mitochondrial respiratory chain complex I (NADH:ubiquinone oxidoreductase). It enables NADH dehydrogenase (ubiquinone) activity and is critically involved in mitochondrial electron transport from NADH to ubiquinone . The protein is encoded by the mitochondrial genome and is located in the mitochondrial inner membrane as part of complex I.

In terms of structure, MT-ND3 contains conserved regions involved in the active/deactive state transition of complex I . This regulatory function is particularly important for modulating energy production in response to changing cellular demands. The protein's amino acid sequence is relatively conserved across species, with notable similarities between vertebrates, indicating its evolutionary importance in mitochondrial function.

Methodologically, researchers studying MT-ND3's basic function should employ techniques such as site-directed mutagenesis to alter specific amino acids in conserved regions, followed by spectrophotometric assays to measure NADH oxidation rates and complex I activity.

How do MT-ND3 variants cause mitochondrial disease?

MT-ND3 variants can disrupt mitochondrial function through several mechanisms, leading to diseases such as Leigh syndrome, mitochondrial complex I deficiency, Leber hereditary optic neuropathy, and potentially contributing to Parkinson's disease . Specific mutations like m.10197G > C and m.10191T > C have been well-documented in the literature .

The pathogenic mechanisms include:

  • Decreased MT-ND3 protein levels: For example, the m.10197G > C variant significantly lowers MT-ND3 protein expression .

  • Impaired complex I assembly: Mutations can disrupt the integration of MT-ND3 into the larger complex I structure .

  • Reduced complex I activity: This leads to decreased electron transport and ATP production .

  • Increased reactive oxygen species (ROS) production: Dysfunctional complex I can leak electrons, leading to oxidative stress.

For Leigh syndrome specifically, there appears to be a strong association between MT-ND3 mutations and epilepsy, particularly with the m.10191T>C mutation . The mutant load (percentage of mitochondrial DNA carrying the mutation) can range from 57.9% to 93.6% in affected patients, though direct correlations between mutant load and disease onset or severity remain somewhat unclear .

What are the latest therapeutic approaches for MT-ND3-related mitochondrial disorders?

Recent advances in treating MT-ND3-related disorders focus on innovative gene therapy approaches:

Allotopic Expression via Codon Optimization:
This strategy involves re-engineering mitochondrial genes for nuclear expression, followed by mitochondrial import of the resulting protein. For MT-ND3, researchers have successfully:

  • Created codon-optimized versions of MT-ND3 for nuclear expression

  • Added mitochondrial targeting sequences to direct the translated protein to mitochondria

  • Demonstrated partial restoration of protein levels, complex I assembly, and ATP production in patient cells with m.10197G > C and m.10191T > C variants

This approach has shown promise as a functional rescue strategy for mutant phenotypes, potentially supplementing ATP requirements in energy-deficient mitochondrial disease patients .

Mitochondrial Base Editing:
Another cutting-edge approach involves direct editing of mitochondrial DNA using deaminase technology:

  • DdCBE (DddA-derived cytosine base editors) pairs containing TALE domains can be designed to target specific mtDNA regions

  • When delivered via adeno-associated viral (AAV) vectors, these editors can modify target cytosines in the MT-ND3 gene

  • Studies in mice have achieved efficient editing of target cytosines, with up to 95% of sequencing reads showing the desired edits

This approach works especially well in younger subjects and post-mitotic tissues, suggesting age-related considerations for therapeutic intervention .

How can heteroplasmy levels be accurately measured and what is their clinical significance?

Accurate measurement of heteroplasmy (the presence of both wild-type and mutant mtDNA) is critical for understanding MT-ND3-related disease progression and therapeutic outcomes:

Measurement Techniques:

  • Next-Generation Sequencing (NGS): This approach allows for quantitative analysis of heteroplasmic mutant load by counting the number of mtDNA reads. The sequenced reads are mapped to the human mitochondria reference (NC_012920) using the Burrows-Wheeler Aligner, and variants are identified using the Genome Analysis Toolkit .

  • Amplification Refractory Mutation System (ARMS) - Quantitative PCR: This method can be used to evaluate changes in heteroplasmy levels after therapeutic interventions such as mRNA delivery to mitochondria .

  • Sanger Sequencing: While less quantitative, this can be used for initial detection of edits in targeted cytosines .

For therapeutic interventions, measuring changes in heteroplasmy before and after treatment provides crucial information about efficacy. Even partial reductions in mutant load can potentially yield clinical benefits by improving mitochondrial function and ATP production.

What experimental systems are optimal for studying recombinant Tetraodon nigroviridis MT-ND3?

When working with recombinant Tetraodon nigroviridis MT-ND3, researchers should consider the following experimental systems and approaches:

Expression Systems:
For producing recombinant MT-ND3 protein:

  • Bacterial expression systems may be suitable for basic structural studies, though they lack post-translational modifications

  • Yeast or insect cell systems may better preserve protein folding and modifications

  • Cell-free systems can be advantageous for expressing membrane proteins like MT-ND3

Storage and Handling:
The recombinant protein should be stored in Tris-based buffer with 50% glycerol at -20°C, with extended storage at -80°C . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided .

Functional Assays:
To assess the activity of recombinant MT-ND3:

  • Complex I assembly assays using blue native polyacrylamide gel electrophoresis (BN-PAGE)

  • NADH:ubiquinone oxidoreductase activity measurements using spectrophotometric methods

  • In vitro reconstitution experiments with other complex I components

Comparative Studies:
Given the evolutionary conservation of MT-ND3, comparative studies between Tetraodon nigroviridis and other species can provide valuable insights. The protein shows high sequence similarity to MT-ND3 from other vertebrates, making cross-species functional analyses informative.

How should experiments be designed to evaluate mitochondrial gene therapy approaches targeting MT-ND3?

When designing experiments to evaluate mitochondrial gene therapy approaches for MT-ND3-related disorders, researchers should consider:

Cell Models:

  • Patient-derived fibroblasts with known MT-ND3 mutations (e.g., m.10197G > C, m.10191T > C)

  • Cybrid cell lines with controlled levels of mutant mtDNA

  • CRISPR-engineered cells with nuclear MT-ND3 expression systems

Delivery Systems:
For allotopic expression approaches:

  • Plasmid vectors containing codon-optimized MT-ND3 with mitochondrial targeting sequences

  • Viral vectors (lentiviral, AAV) for more efficient delivery

  • MITO-Porter systems for direct delivery of mRNA to mitochondria

For base editing approaches:

  • AAV vectors carrying DdCBE pairs with TALE domains targeting MT-ND3 regions

  • Transfection followed by fluorescence-activated cell sorting (FACS) for in vitro studies

Assessment Parameters:
Key measurements should include:

  • MT-ND3 protein levels via western blotting

  • Complex I assembly and activity using BN-PAGE and enzymatic assays

  • ATP production measurements

  • Heteroplasmy levels using NGS or ARMS-qPCR

  • Mitochondrial respiration using oxygen consumption rate measurements

  • mtDNA copy number to ensure maintenance of mitochondrial genome integrity

Controls:

  • Untreated patient cells

  • Cells treated with non-targeting or scrambled sequences

  • Healthy control cells

  • Age-matched controls for in vivo studies

What statistical approaches are appropriate for analyzing MT-ND3 mutation data?

When analyzing data related to MT-ND3 mutations and therapeutic interventions, researchers should employ the following statistical approaches:

For Mutation Analysis:

  • Descriptive statistics including median and range for presenting mutant load data

  • Pearson correlation coefficients to assess relationships between continuous variables (e.g., mutant load vs. clinical parameters)

  • Statistical significance should be set at p < 0.05

  • SPSS or similar statistical software packages for comprehensive analysis

For NGS Data:

  • Quality filtering of sequence variants using appropriate parameters

  • Quantitative analysis of heteroplasmic mutant load by counting mtDNA reads

  • Presentation of mutation frequencies as percentages with confidence intervals

For Therapeutic Effect Evaluation:

  • Paired t-tests or Wilcoxon signed-rank tests to compare pre- and post-treatment parameters

  • ANOVA for comparing multiple treatment conditions

  • Correlation analyses between heteroplasmy reduction and functional improvements

  • Survival analysis for long-term in vivo studies

How can researchers differentiate between pathogenic and non-pathogenic variants in MT-ND3?

Distinguishing pathogenic from non-pathogenic variants in MT-ND3 requires a multi-faceted approach:

Functional Analyses:

  • Measure the impact on MT-ND3 protein levels

  • Assess complex I assembly and activity deficiency

  • Evaluate ATP synthesis reduction

Conservation Analysis:
Examine the conservation of the affected amino acid across species. MT-ND3 has conserved regions involved in the active/deactive state transition of complex I . Mutations in highly conserved regions are more likely to be pathogenic.

Clinical Correlation:
Analyze the association between specific mutations and clinical phenotypes, such as the strong association between certain MT-ND3 mutations (particularly m.10191T>C) and epilepsy in Leigh syndrome .

Heteroplasmy Assessment:
Evaluate the relationship between mutant load and disease severity. For MT-ND3 mutations causing Leigh syndrome, mutant loads typically range from 57.9% to 93.6% .

Database Integration:
Compare findings with established databases such as ClinVar, which contains reports of MT-ND3 variants and their clinical significance .

What emerging technologies could advance MT-ND3 research?

Several cutting-edge technologies hold promise for advancing MT-ND3 research:

Cryo-Electron Microscopy:
High-resolution structural analysis of MT-ND3 within the context of respiratory complex I could reveal detailed insights into how mutations affect protein-protein interactions and complex assembly.

Single-Cell Mitochondrial Analysis:
Technologies enabling the study of mitochondrial heteroplasmy and function at the single-cell level could help understand the cellular mosaicism that occurs in mitochondrial diseases.

In Vivo Mitochondrial Imaging:
Advanced imaging techniques to visualize mitochondrial function in living tissues could provide real-time assessment of therapeutic interventions targeting MT-ND3.

CRISPR-Based Mitochondrial Genome Editing:
Development of more precise and efficient mitochondrial genome editing tools beyond current base editors could enable correction of a wider range of MT-ND3 mutations.

Induced Pluripotent Stem Cell (iPSC) Disease Models:
Generation of patient-specific iPSCs and their differentiation into affected cell types (neurons, muscle cells) could provide more physiologically relevant models for studying MT-ND3 mutations.

What are the key challenges in translating MT-ND3 research to clinical applications?

The translation of MT-ND3 research to clinical applications faces several significant challenges:

Delivery Mechanisms:
Efficient delivery of therapeutic agents to mitochondria in relevant tissues remains challenging. While AAV delivery has shown promise in mouse models , optimizing delivery for human clinical applications requires further development.

Age-Dependent Efficacy:
Evidence suggests that mitochondrial gene therapy approaches may be more effective in younger subjects , raising questions about timing interventions and whether benefits can be achieved in patients with established disease.

Heteroplasmy Threshold Effects:
Understanding the minimum reduction in mutant load required for clinical benefit is essential for establishing therapeutic endpoints. The relationship between heteroplasmy levels and clinical outcomes is complex and not always linear .

Tissue Specificity:
MT-ND3 mutations may affect different tissues with varying severity. Therapeutic approaches will need to address the most affected tissues, which often include high-energy demanding organs like the brain, heart, and muscles.

Long-Term Safety: The long-term safety and stability of genetic interventions targeting MT-ND3 require extensive evaluation, particularly for techniques involving mitochondrial DNA editing.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.