Recombinant Tetraodon nigroviridis Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Definition and Molecular Overview

Recombinant Tetraodon nigroviridis Rhodopsin (Rho) is a genetically engineered form of the visual pigment rhodopsin derived from the spotted green pufferfish (Tetraodon nigroviridis). This protein is produced in Escherichia coli (E. coli) expression systems, fused with an N-terminal histidine (His) tag for purification and detection purposes. Rhodopsin, a G-protein-coupled receptor (GPCR), plays a central role in phototransduction by binding the chromophore 11-cis-retinal, which isomerizes to all-trans-retinal upon light exposure .

Key Molecular Features:

PropertyDetails
UniProt IDQ9DGG4
Amino Acid Sequence353 residues (MNGTEGPFFYVPMLNTTGIVRSPYDYPQYYLVNPAAYAALGAYMFLLILL...)
Expression HostE. coli
TagN-terminal His tag
Post-Translational ModificationsLacks native glycosylation due to prokaryotic expression

Production Data:

ParameterSpecification
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C; avoid freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in deionized water + 50% glycerol
ApplicationsSDS-PAGE, ELISA, structural studies

4.1. Mechanistic Studies of Retinal Binding

  • Photoactivation Dynamics: The recombinant protein serves as a model for studying light-induced conformational changes. Mutations analogous to human pathogenic variants (e.g., T4K, T17M) disrupt folding or retinal binding, mimicking autosomal dominant retinitis pigmentosa (adRP) .

  • Thermal Sensitivity: TM2 and TM7 mutations in rhodopsin exhibit temperature-dependent misfolding, a feature exploited to study pharmacological chaperones like 9-cis-retinal .

4.2. Biotechnological Applications

  • Structural Biology: Used in crystallography and molecular dynamics simulations to resolve GPCR activation mechanisms .

  • Drug Screening: Serves as a template for designing retinal analogs or small-molecule correctors for adRP .

Limitations and Future Directions

While recombinant T. nigroviridis rhodopsin lacks post-translational modifications (e.g., glycosylation), limiting its utility in studying native trafficking , its stability in prokaryotic systems makes it ideal for high-throughput assays. Future work may focus on:

  • Engineering glycosylated variants using eukaryotic expression systems.

  • Investigating interspecies differences in retinal-binding kinetics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rho; rhod; GSTENG00033246001; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis)
Target Names
rho
Target Protein Sequence
MNGTEGPFFYVPMLNTTGIVRSPYDYPQYYLVNPAAYAALGAYMFLLILLGFPINFLTLY VTIEHKKLRTPLNYILLNLAVANLFMVFGGFTTTMYTSMHGYFVLGRLGCNLEGFFATLG GEIGLWSLVVLAIERWMVVCKPISNFRFGENHAIMGLAFTWIMACACAVPPLVGWSRYIP EGMQCSCGVDYYTRAEGFNNESFVVYMFICHFLIPMAVVFFCYGRLLCAVKEAAAAQQES ETTQRAEREVTRMVVIMVVAFLICWLPYAGVAWWIFTHQGSEFGPVFMTIPAFFAKSSSI YNPLIYICMNKQFRHCMITTLCCGKNPFEEEEGASTTSKTEASSVSSSSVSPA
Uniprot No.

Target Background

Function
Recombinant Tetraodon nigroviridis Rhodopsin (rho) is a photoreceptor crucial for low-light vision. While most marine fish utilize retinal as a chromophore, freshwater fish often employ 3-dehydroretinal, or a combination of both. Light-induced isomerization of 11-cis to all-trans retinal initiates a conformational change, activating signaling via G-proteins. Subsequent receptor phosphorylation, mediated by arrestin, displaces the bound G-protein alpha subunit, terminating the signaling cascade.
Database Links
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

Basic Research Questions

  • What is Tetraodon nigroviridis rhodopsin and why is it used in comparative vision research?

    Tetraodon nigroviridis rhodopsin (rho) is a G-protein-coupled receptor (GPCR) belonging to the rhodopsin family found in the spotted green pufferfish. This visual pigment plays a central role in light detection for scotopic (dim-light) vision. The protein consists of 353 amino acids with seven transmembrane domains typical of GPCRs . Researchers use this rhodopsin as a comparative model because teleost fish like Tetraodon provide valuable insights into vertebrate rhodopsin evolution. Tetraodon has been established as a compact reference vertebrate genome for gene finding and validation , making its rhodopsin particularly useful for evolutionary studies of visual systems.

  • How does the gene structure of Tetraodon nigroviridis rhodopsin compare to that of other vertebrates?

    Tetraodon nigroviridis shows unique patterns in its rhodopsin gene arrangement compared to tetrapods. While tetrapods typically show highly conserved IRBP (interphotoreceptor retinoid-binding protein) gene structure associated with rhodopsin function, teleost fish like Tetraodon exhibit a two-gene IRBP locus arranged head-to-tail . This arrangement consists of:

    • Gene 1: Intronless with a single large exon encoding three complete Repeats

    • Gene 2: Contains two Repeats spread across four exons and three introns

    This structure differs significantly from the tetrapod pattern and suggests potential neofunctionalization or sub-function partitioning in teleost visual systems, likely arising from whole genome duplication or tandem gene duplication events .

  • What expression systems are most effective for producing recombinant Tetraodon nigroviridis rhodopsin?

    E. coli is the predominant expression system for recombinant Tetraodon nigroviridis rhodopsin production. When expressing the full-length protein (353 amino acids), a His-tag fusion is typically incorporated at the N-terminus to facilitate purification . The methodology involves:

    1. Cloning the full rhodopsin coding sequence into an appropriate expression vector

    2. Transforming E. coli with the construct

    3. Inducing expression under optimized conditions

    4. Lysing cells and purifying via His-tag affinity chromatography

    5. Lyophilizing the purified protein for storage

    Alternative eukaryotic expression systems like HEK293 cells are sometimes preferred for functional studies, especially when post-translational modifications and proper folding are critical .

  • How does Tetraodon nigroviridis rhodopsin fit into the evolutionary context of vertebrate visual pigments?

    Tetraodon nigroviridis represents an important model in understanding rhodopsin evolution in vertebrates. Key evolutionary insights include:

    1. Teleost fish underwent whole genome duplication events that affected opsin gene evolution

    2. Tetraodon displays an expansion of opsin receptors (27 members) compared to humans (9 members)

    3. The rhodopsin family in Tetraodon has approximately 1.5 times the number of receptors compared to humans (excluding olfactory receptors)

    4. Phylogenetic analysis divides Tetraodon opsins into three main branches: classical visual pigments, neuropsin/RGR-like, and encephalopsin/melanopsin-like

    This expansion suggests fish-specific gene duplications that likely contributed to visual adaptations in aquatic environments .

Advanced Research Questions

  • How can thermal stability and isomerization rates of Tetraodon nigroviridis rhodopsin be experimentally measured?

    Measuring thermal stability and isomerization rates of Tetraodon rhodopsin requires sophisticated biophysical approaches:

    Methodology for thermal isomerization rate (kth) determination:

    1. Purify the recombinant rhodopsin in a detergent system (typically 0.1% DDM)

    2. Reconstitute with 11-cis-retinal under dark conditions

    3. Conduct fluorescence spectroscopy measurements using:

      • Excitation wavelength: 295 nm (1.5 nm slit width)

      • Emission wavelength: 330 nm (10 nm slit width)

      • Temperature maintained at 20°C using a Peltier controller

    4. Monitor tryptophan fluorescence changes as a proxy for retinal release

    5. Calculate rates using the Hinshelwood distribution equation:
      kth=Aexp(Ea/RT)k_{th} = A \cdot \exp(-E_a/RT)
      where R is the gas constant, T is absolute temperature, and m is the number of molecular vibrational modes

    This approach has revealed that thermal isomerization rates can vary significantly between different rhodopsins and are correlated with the decay rates of the active state, providing insights into the molecular mechanisms of rhodopsin activation .

  • What methodologies are optimal for studying chromophore-opsin interactions in Tetraodon nigroviridis rhodopsin?

    Studying chromophore-opsin interactions in Tetraodon rhodopsin can be accomplished through:

    Retinal release kinetics protocol:

    1. Prepare purified rhodopsin samples in sodium phosphate buffer (50 mM NaPhos, 0.1% DM, pH 7)

    2. Incubate at controlled temperature (20°C) using submicro fluorometer cell cuvettes

    3. Bleach for 30 seconds using a light source with wavelengths above 475 nm

    4. Measure fluorescence at 30-second intervals (excitation: 295 nm, emission: 330 nm)

    5. Plot the fluorescence intensity over time to determine the retinal release half-life

    Chromophore exchange assay:

    1. Reconstitute rhodopsin with 11-cis-retinal in the dark

    2. Expose to 9-cis-retinal in solution

    3. Monitor spectral shifts indicative of chromophore exchange

    These approaches have demonstrated that some rhodopsins exhibit different abilities to exchange retinal, suggesting variations in the "openness" of the chromophore binding pocket . For example, while zebrafish blue-opsin allows retinal exchange, rhodopsin typically does not, indicating fundamental differences in binding pocket accessibility.

  • How have gene duplication events influenced rhodopsin diversity and function in Tetraodon nigroviridis?

    Gene duplication events have played a crucial role in rhodopsin evolution in Tetraodon:

    1. Whole genome duplication (WGD): The teleost-specific genome duplication created opportunities for subfunctionalization and neofunctionalization of rhodopsin genes

    2. Delayed rediploidization: Analysis reveals that ancestral chromosomes 3, 10, and 11 experienced delayed rediploidization in teleosts, with continued genetic exchange between homeologs for approximately 60 million years after the teleost whole genome duplication

    3. Chromosomal distribution pattern: Tetraodon GPCRs, including rhodopsins, show a unique distribution across chromosomes with duplicate copies typically located on different chromosomes, exhibiting a 2:1 ratio when compared to human counterparts

    4. Functional consequences: These duplications likely contributed to visual system adaptations through:

      • Expansion of spectral sensitivity range

      • Potential specialization for different light environments

      • Novel protein-protein interactions in visual signaling cascades

    The data strongly suggests that the teleost ancestor was an autotetraploid, which influenced the evolution of its visual system through these duplication events .

  • What techniques can be employed to investigate the role of specific amino acid residues in Tetraodon rhodopsin function?

    Investigating specific amino acid contributions to Tetraodon rhodopsin function requires integrating several techniques:

    Site-directed mutagenesis approach:

    1. Construct mutants using In-Fusion cloning or similar techniques

    2. Express wild-type and mutant proteins in HEK293 cells

    3. Purify using Rho1D4-conjugated agarose chromatography

    Functional characterization:

    1. Spectroscopic analysis to determine absorption maxima (λmax)

    2. Thermal stability measurements through monitoring the rate of thermal bleaching

    3. G-protein activation assays to assess signaling efficiency

    4. Retinal release assays to determine chromophore stability

    Evolutionary analysis:

    1. Calculate nonsynonymous (dN) and synonymous (dS) substitution rates

    2. Employ selection analysis models (PAML codeml package) to detect positive selection

    3. Compare intracellular vs. extracellular loop substitution patterns

    For example, position 47 has been identified as critical in anuran blue-sensitive cone pigments, where a single mutation to threonine significantly reduced thermal isomerization rates to rhodopsin-like levels . Similar studies in Tetraodon could reveal adaptations specific to its aquatic environment.

  • How does Tetraodon nigroviridis rhodopsin compare to other fish rhodopsins in terms of adaptation to different light environments?

    Tetraodon nigroviridis rhodopsin shows specific adaptations when compared to other fish rhodopsins:

    Comparative properties:

    SpeciesRetinal Release Half-lifeThermal StabilitySpectral Tuning Features
    Zebrafish Rhodopsin6.5 ± 0.3 minHigherOptimized for freshwater environments
    Fish Rh1-2 (second rhodopsin)7.6 ± 0.8 minSimilar to Rh1Function still being characterized
    Fish Exo-rhodopsin (non-visual)1.6 ± 0.3 minLowerDifferent photochemical properties
    Tetraodon nigroviridis RhodopsinExpected to be specializedAdapted for brackish environmentLikely tuned to shallow water habitats

    Adaptation mechanisms:

    1. Selection on key residues controlling spectral absorption maxima

    2. Modifications to retinal-binding pocket structure affecting chromophore stability

    3. Alterations in G-protein coupling efficiency

    4. Evolution of thermal stability appropriate for habitat temperature ranges

    These differences reflect adaptations to diverse aquatic light environments, from freshwater to brackish conditions, with Tetraodon's rhodopsin likely specialized for its natural habitat in Southeast Asian rivers and estuaries where it experiences variable salinity and light conditions .

  • What are the most effective approaches for improving recombinant expression and stability of Tetraodon nigroviridis rhodopsin?

    Optimizing recombinant Tetraodon rhodopsin expression requires addressing several key challenges:

    Expression optimization strategy:

    1. Vector optimization:

      • Use strong, inducible promoters (e.g., T7 for E. coli, CMV for mammalian cells)

      • Incorporate appropriate fusion tags (His, FLAG, or Rho1D4 epitope tags)

    2. Expression system selection:

      • E. coli: Higher yield but lacks post-translational modifications

      • HEK293 cells: Better folding and modifications but lower yield

      • Insect cells: Balance between yield and proper folding

    3. Stabilization approaches:

      • Add stabilizing agents during purification (e.g., glycerol at 5-50%)

      • Optimize detergent selection (DDM, DM, or LMNG)

      • Consider lipid nanodisc incorporation for native-like environment

    4. Storage optimization:

      • Lyophilization with 6% trehalose at pH 8.0

      • Aliquoting to avoid freeze-thaw cycles

      • Storage at -80°C for long-term stability

    These approaches address the inherent instability of GPCRs while maintaining functional properties essential for experimental analysis. When properly executed, they can significantly improve both yield and stability of recombinant Tetraodon rhodopsin .

  • How can computational methods be utilized to predict functional differences between Tetraodon nigroviridis rhodopsin and other vertebrate visual pigments?

    Computational approaches offer powerful tools for analyzing Tetraodon rhodopsin:

    Structural modeling methodology:

    1. Homology modeling using crystal structures of bovine or squid rhodopsin as templates

    2. Molecular dynamics simulations to analyze conformational flexibility

    3. Quantum mechanical calculations for spectral tuning predictions

    Evolutionary computation approach:

    1. Calculate site-specific selection pressures using maximum likelihood methods

    2. Implement random sites models (M0-M8) to detect selection signatures

    3. Apply branch-site and clade models to identify lineage-specific selection

    Specific analyses for Tetraodon:

    1. Analysis of the retinal binding pocket architecture

    2. Prediction of G-protein coupling efficiency

    3. Evaluation of thermal isomerization probability based on structural flexibility

    These computational approaches have successfully identified selected residues in rhodopsins across species. For example, studies have detected positive selection in specific residues of fish rhodopsins that correlate with adaptation to different light environments. The preexponential factor (A) in the thermal isomerization equation, which reflects binding pocket flexibility, can be computationally predicted and experimentally verified .

  • What are the implications of rhodopsin gene duplication in Tetraodon nigroviridis for understanding visual adaptation in teleost fish?

    The rhodopsin gene duplication in teleosts has profound implications for understanding visual adaptation:

    Key findings from teleost rhodopsin duplication studies:

    1. Second visual rhodopsin gene (rh1-2) has been identified in several ray-finned fishes

    2. Zebrafish expression studies show differential expression patterns of duplicate rhodopsins

    3. Retinal release kinetics of duplicated genes show functional differentiation

    4. Duplicated rhodopsins show evidence of subfunctionalization or neofunctionalization

    Evolutionary significance:

    1. Provides mechanism for adaptation to diverse aquatic light environments

    2. Allows specialized visual function without compromising ancestral roles

    3. Creates genetic redundancy permitting evolutionary experimentation

    4. Explains the exceptional diversity of visual systems in teleost fishes

    Research implications:
    The study of Tetraodon's duplicated rhodopsin genes offers a model system for understanding how gene duplication contributes to sensory adaptation. This has broader applications in understanding:

    • The role of gene duplication in evolution

    • Mechanisms of protein functional specialization

    • Adaptation to novel environmental challenges

    • The molecular basis of sensory diversity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.