Recombinant Tetraodon nigroviridis XK-related protein 6 (xkr6)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Mechanisms

xkr6 is implicated in critical cellular processes, including:

  • Apoptosis and Phosphatidylserine Exposure: Predicted involvement in apoptotic cell engulfment and phosphatidylserine externalization .

  • Lipid Dynamics: Functions alongside VPS13 proteins in bulk lipid transfer, a mechanism disrupted in neurodegenerative disorders like McLeod syndrome .

  • Immune Regulation: Associated with pathways involving complement proteins (e.g., C3, C1qA) and JAK-STAT signaling in fish models .

Key Pathways and Interactions

Pathway/InteractionRole of xkr6Source
Apoptotic Cell ClearancePromotes phagocytosis by marking apoptotic cells via phosphatidylserine
Lipid TransferCollaborates with VPS13A in membrane deformation and lipid trafficking
Immune ResponseLinked to complement activation (C3, C1qA) and chemokine signaling

Research Applications and Findings

xkr6 serves as a model protein for studying:

  • Evolutionary Adaptations: T. nigroviridis (pufferfish) has a streamlined genome, making xkr6 useful for comparative immunology studies .

  • Disease Modeling: Insights into lipid transfer disorders (e.g., chorea-acanthocytosis) through structural and functional studies .

  • Mechanistic Insights: Multi-omics approaches in T. nigroviridis highlight xkr6’s role in inflammatory responses and pathogen recognition .

Table 2: Comparative Analysis of Recombinant XK-related Proteins

SpeciesHost SystemFunctionally Relevant DomainKey ApplicationSource
T. nigroviridis (xkr6)E. coliTransmembrane, lipid-bindingApoptosis, immune regulation
Mouse (Xkr6)Mammalian cellsPhosphatidylserine exposureNeurodegeneration models
Rat (Xkr6)Cell-free systemsMembrane integrityBulk lipid transfer studies

Clinical and Biological Relevance

  • Disease Associations: Mutations in XK-related proteins are linked to McLeod syndrome (hemolysis, neuropsychiatric symptoms) and chorea-acanthocytosis .

  • Therapeutic Potential: Understanding xkr6’s lipid transfer functions could inform treatments for neurodegenerative disorders .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will strive to accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Important: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
xkr6; xrg6; GSTENG00030285001; GSTENG00030286001; XK-related protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-578
Protein Length
full length protein
Species
Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis)
Target Names
xkr6
Target Protein Sequence
MAAKSDGRGVVTGFAQLHNLDEVVGTGEDDARNGSSFHICHCCNTSSCYWGCRSACLHYL RAKGKGEGKETARPTPEERLWLDCLWIVLALLVFFWDVGTDLWLAVDYYHKQDFLWSGLT LFFVLVPSVLVQILSFRWFVQDYTGGGLGSVEGLSSRRAAASLQRDKCCRLSVWIWQTVI HIFQLGQVWRYIRTMYLGIQSHRQKENQRRFYWAMMYEYADVNMLRLLETFLESAPQLVL QLCIMIQSNKAEWLQCVSALSSLLSLAWVLASYHKLLRDSRDDKKSMSYRGALVHLFWRL FTISSRVLSLALFASVFHIYFGIFVVLHWCAMAFWVIHGGTDFCMSKWEEVLFNMVVGVV YVFCWFNVREGRTRYRMVAYYVVVLLENVILTSLWYAYRDPATTDAYASLALCGVFLCFA SGVACMVLYYGVLHPMGPRLRVLASSCCAELLWGLPLPPEAEPMAPTPGPRGSQATPTRG LTGEYAESDETATDTCLPVFQVRSTEPVDAAGRPIQPEGPFIKIDMPRKRYPAWDAHFVD RRLRRTVNVLQYISPNAAGIRYRDGPLLYELLQYESSL
Uniprot No.

Target Background

Database Links
Protein Families
XK family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Tetraodon nigroviridis XK-related protein 6 (xkr6)?

Recombinant Tetraodon nigroviridis XK-related protein 6 (xkr6) is a full-length transmembrane protein derived from the spotted green pufferfish (Tetraodon nigroviridis). The protein is typically expressed in vitro using E. coli expression systems and is available with an N-terminal 10xHis-tag. The complete amino acid sequence consists of 578 amino acids with multiple transmembrane domains .

The protein belongs to the XK-related family, which has been implicated in various biological processes including lipid metabolism and membrane dynamics. The Tetraodon nigroviridis species is particularly valuable for research due to its compact genome, which has undergone whole-genome duplication in the teleost fish lineage after divergence from mammals .

What are the optimal storage conditions for Recombinant Tetraodon nigroviridis XK-related protein 6?

For optimal stability and activity, Recombinant Tetraodon nigroviridis XK-related protein 6 should be stored at -20°C for regular use. For extended storage periods, conservation at -20°C or -80°C is recommended. It is crucial to avoid repeated freeze-thaw cycles, as these can significantly degrade the protein and reduce its activity. Working aliquots can be stored at 4°C for up to one week .

The shelf life of the protein depends on several factors, including storage state, buffer ingredients, storage temperature, and the inherent stability of the protein itself. Generally, liquid formulations have a shelf life of approximately 6 months at -20°C/-80°C, while lyophilized forms can maintain stability for up to 12 months at the same temperatures .

How does the evolutionary history of Tetraodon nigroviridis impact research on xkr6?

Tetraodon nigroviridis possesses the smallest known vertebrate genome among vertebrates, making it an excellent model organism for comparative genomics. The evolutionary significance of studying xkr6 in this species stems from the whole-genome duplication event that occurred in the teleost fish lineage after its divergence from mammals .

This genomic feature allows researchers to investigate:

  • Functional divergence of duplicated genes

  • Evolutionary constraints on conserved protein domains

  • Taxonomic differences in protein function across vertebrate lineages

Analysis of the Tetraodon genome compared to the human genome has revealed approximately 900 previously unannotated human genes, highlighting the value of this model organism in understanding vertebrate gene evolution. The analysis of these genomes has also enabled researchers to infer the basic structure of the ancestral bony vertebrate genome, which comprised 12 chromosomes, and to reconstruct the evolutionary history of chromosome rearrangements leading to the modern human karyotype .

What experimental approaches are optimal for studying xkr6 function in lipid metabolism?

To effectively study xkr6 function in lipid metabolism, a multi-faceted experimental design is recommended:

  • Genetic Association Studies: Investigate specific SNPs like rs7014968 that have been associated with lipid traits. Research has shown that the XKR6 rs7014968C allele carriers had higher serum total cholesterol (TC) levels than non-carriers (p = 0.025) .

  • In Vitro Expression Systems: Utilize recombinant protein expression in systems that preserve post-translational modifications. While E. coli expression systems are commonly used , consider mammalian or insect cell systems for studies focused on function rather than structure.

  • Experimental Design for Causality Assessment:

    • Define variables clearly (independent variable: xkr6 expression/activity; dependent variable: lipid levels)

    • Formulate specific, testable hypotheses

    • Design appropriate control groups

    • Apply randomization

    • Control for extraneous variables

  • Gene Knockdown/Knockout Studies: CRISPR-Cas9 or RNA interference techniques can be employed to assess the effect of reduced xkr6 function on lipid profiles.

Research has demonstrated that the XKR6 rs7014968 SNP correlates with increased serum TC levels, potentially contributing to an elevated risk of coronary heart disease and ischemic stroke . When designing experiments to explore this relationship, control for confounding factors including sex, age, blood pressure, cigarette smoking, BMI, and alcohol consumption.

How can contradictions in xkr6 research findings be systematically addressed?

Addressing contradictions in xkr6 research findings requires a structured approach:

  • Contradiction Detection Methodology:

    • Apply a structured approach for utilizing Natural Language Inference (NLI) models to detect contradictions in research literature

    • Pair statements about xkr6 function or effects separately before analysis

    • Establish a contradiction probability threshold (typically τ = 0.5) for determining whether findings are truly contradictory

  • Experimental Validation Framework:

    • Implement a systematic replication strategy for key findings

    • Vary experimental conditions to identify context-dependent effects

    • Document all methodology details to enable proper comparison between studies

  • Stratified Analysis:

    • Segment data by relevant factors (e.g., sex, age, BMI) to identify subgroup-specific effects

    • For example, research has shown that XKR6 rs7014968C allele carriers in female, age >60 years, BMI >24 kg/m², and hypertension subgroups had a higher risk of CHD than counterparts

  • Meta-analytical Approach:

    • Pool data from multiple studies to increase statistical power

    • Apply random-effects models to account for between-study heterogeneity

    • Conduct sensitivity analyses to identify sources of contradiction

SubgroupRisk Association with XKR6 rs7014968C for CHDRisk Association with XKR6 rs7014968C for IS
FemaleIncreased riskNot significantly increased
MaleNot significantly increasedIncreased risk
Age >60 yearsIncreased riskNot significantly increased
BMI >24 kg/m²Increased riskIncreased risk
SmokersNot significantly increasedIncreased risk
HypertensionIncreased riskIncreased risk

Table 1: Stratified analysis of risk associations with XKR6 rs7014968C allele across different subgroups

What are the structural and functional relationships between xkr6 and apoptotic pathways?

The investigation of xkr6's role in apoptotic pathways should consider:

  • Structural Analysis:

    • XK-related proteins contain multiple transmembrane domains that may interact with other apoptotic regulators

    • The N-terminal region appears critical for protein-protein interactions relevant to cell death pathways

    • Analysis of conserved domains across species can identify functional motifs

  • Functional Assessment Methodology:

    • Measure phosphatidylserine exposure on cell surfaces as XK-related proteins may be involved in membrane phospholipid scrambling during apoptosis

    • Evaluate interactions with known apoptotic regulators like IAPs (Inhibitor of Apoptosis Proteins)

    • Assess the impact of xkr6 expression on caspase activation pathways

  • Evolutionary Context:

    • Compare functional conservation between Tetraodon nigroviridis xkr6 and mammalian homologs

    • Evaluate the impact of genome duplication events on functional divergence of xkr6 in teleost fish versus mammals

The relationship between xkr6 and apoptosis may be analogous to the role of other proteins involved in programmed cell death regulation. Research on Drosophila apoptosis regulators has shown that proteins with seemingly divergent sequences can have conserved functions in cell death pathways . Experimental approaches should include both gain-of-function and loss-of-function studies to comprehensively characterize xkr6's role in apoptotic signaling.

What is the optimal experimental design for assessing xkr6 variants and their phenotypic effects?

When designing experiments to assess xkr6 variants and their phenotypic effects, researchers should implement a rigorous framework:

  • Define Variables Precisely:

    • Independent variable: xkr6 genetic variants (e.g., rs7014968 SNP)

    • Dependent variables: lipid profiles, apoptotic markers, or other relevant phenotypes

    • Control for extraneous variables: age, sex, BMI, medical conditions

  • Formulate Testable Hypotheses:

    • Null hypothesis (H₀): "There is no difference in serum TC levels between individuals with different xkr6 variants"

    • Alternative hypothesis (H₁): "Individuals with the XKR6 rs7014968C allele have higher serum TC levels than non-carriers"

  • Design Appropriate Treatment Groups:

    • Consider both between-subjects (comparing different individuals with various genotypes) and within-subjects designs (comparing the same individuals under different conditions)

    • Implement randomization when possible to minimize selection bias

    • Use stratification for subgroup analysis based on demographic or clinical factors

  • Statistical Considerations:

    • Power analysis to determine adequate sample size

    • Multiple testing correction for genomic studies

    • Covariance analysis with adjustment for relevant factors (sex, age, blood pressure, etc.)

  • Validation Strategy:

    • Independent replication in different populations

    • Functional validation using in vitro and in vivo models

    • Cross-validation with related phenotypes

A well-designed study should follow the five key steps of experimental design: considering variables and their relationships, writing specific hypotheses, designing experimental treatments, properly assigning subjects to groups, and planning appropriate measurement of dependent variables .

How can recombinant xkr6 protein be effectively used in protein-protein interaction studies?

To effectively utilize recombinant xkr6 protein in protein-protein interaction studies:

  • Protein Production Optimization:

    • The full-length xkr6 protein (578 amino acids) can be expressed in E. coli systems with an N-terminal 10xHis-tag

    • Consider expression in mammalian or insect cells for studies requiring proper folding of transmembrane domains

    • Optimize purification protocols to maintain native conformation

  • Interaction Detection Methods:

    • Co-immunoprecipitation: Utilize the N-terminal 10xHis-tag for pulldown assays

    • Yeast Two-Hybrid: Consider using specific domains rather than the full transmembrane protein

    • Surface Plasmon Resonance: Quantify binding kinetics to potential partners

    • Proximity Labeling: BioID or APEX2 approaches for in vivo interaction networks

  • Controls and Validation:

    • Include non-specific binding controls (e.g., irrelevant His-tagged proteins)

    • Validate interactions using multiple methodologies

    • Perform competition assays with unlabeled protein to confirm specificity

  • Analytical Considerations:

    • Account for the hydrophobic nature of this transmembrane protein in assay design

    • Use mild detergents to maintain protein solubility without disrupting interactions

    • Consider reconstitution in lipid nanodisc systems for more physiological conditions

The methodological approach should be tailored to the specific research question, with particular attention to maintaining the native conformation of this multi-pass transmembrane protein. Storage conditions (-20°C for regular use, -80°C for extended storage) should be strictly adhered to in order to maintain protein integrity throughout the experimental process .

What statistical approaches are most appropriate for analyzing genetic association studies involving xkr6?

For robust analysis of genetic association studies involving xkr6:

  • Hardy-Weinberg Equilibrium Testing:

    • Verify genotype distributions using standard goodness-of-fit tests before proceeding with association analyses

  • Association Analysis Methods:

    • Covariance Analysis: Adjust for sex, age, blood pressure, cigarette smoking, BMI, and alcohol consumption when testing associations between xkr6 genotypes and lipid traits

    • Non-Parametric Tests: Use Wilcoxon-Mann-Whitney test for non-normally distributed variables like serum triglyceride levels

    • Logistic Regression: Calculate odds ratios (OR) and 95% confidence intervals (CI) for disease risk associated with specific variants

  • Multiple Testing Correction:

    • Apply Bonferroni correction or false discovery rate (FDR) methods when testing multiple SNPs or phenotypes

    • Consider the effective number of independent tests when determining significance thresholds

  • Stratified Analysis Framework:

    • Segment analysis by key demographic and clinical factors

    • Test for gene-environment interactions through formal interaction terms in regression models

  • Meta-Analysis Considerations:

    • Use fixed-effects or random-effects models based on heterogeneity assessment

    • Conduct sensitivity analyses to identify sources of between-study variation

In previous research, statistical significance was determined at P < 0.05, with adjustments made for multiple covariates in both the association analysis between genotypes and lipid levels and in the risk assessment for cardiovascular outcomes .

How should contradictory findings about xkr6 function be integrated into a coherent understanding?

To integrate contradictory findings about xkr6 function:

  • Systematic Evidence Evaluation:

    • Apply a structured approach using NLI models to quantify contradictions between findings

    • Calculate contradiction probabilities between paired statements (threshold τ = 0.5)

    • Identify the specific utterances that contribute to contradictions

  • Context-Based Reconciliation:

    • Categorize contradictions based on study populations, methodologies, and experimental conditions

    • Identify population-specific effects (e.g., the association between XKR6 rs7014968 and disease risk varies by demographic subgroups)

    • Consider temporal factors and technology advancements that might explain discrepancies

  • Bayesian Integration Framework:

    • Develop prior probability distributions based on existing knowledge

    • Update beliefs with new evidence using Bayesian methods

    • Generate posterior probability distributions that incorporate all available data

  • Biological Plausibility Assessment:

    • Evaluate contradictory findings in light of known biological mechanisms

    • Consider evolutionary context, including the whole-genome duplication in the teleost fish lineage

    • Assess functional conservation between species

  • Research Gap Identification:

    • Identify specific questions requiring further investigation to resolve contradictions

    • Propose methodological improvements to address limitations in existing studies

This integrative approach allows researchers to develop a nuanced understanding of xkr6 function that accommodates apparently contradictory findings by recognizing context-specific effects and methodological differences across studies.

What are the most promising areas for future xkr6 research based on current knowledge gaps?

Based on current knowledge and identified gaps, the following research directions hold particular promise:

  • Comparative Functional Genomics:

    • Investigate functional conservation and divergence between xkr6 in Tetraodon nigroviridis and mammalian homologs

    • Explore the consequences of the teleost-specific genome duplication on xkr6 function

    • Map the evolutionary history of XK-related proteins across vertebrate lineages

  • Structural Biology Approaches:

    • Determine the three-dimensional structure of xkr6 to understand its membrane topology

    • Identify critical domains for protein-protein interactions and lipid metabolism

    • Develop structural models to predict functional consequences of genetic variants

  • Systems Biology Integration:

    • Map the interaction network of xkr6 with other proteins involved in lipid metabolism and apoptosis

    • Develop mathematical models of xkr6's role in cholesterol homeostasis

    • Integrate transcriptomic, proteomic, and metabolomic data to understand system-level effects

  • Translational Research Applications:

    • Investigate xkr6 as a potential therapeutic target for dyslipidemia

    • Explore the utility of xkr6 genetic variants as biomarkers for cardiovascular disease risk

    • Develop precision medicine approaches based on xkr6 genotype-phenotype correlations

  • Advanced Experimental Designs:

    • Implement Mendelian randomization studies to establish causality between xkr6 variants and disease outcomes

    • Develop conditional knockout models to study tissue-specific effects

    • Apply CRISPR-based screens to identify genetic modifiers of xkr6 function

Addressing these research areas will require interdisciplinary approaches combining genomics, structural biology, biochemistry, and clinical research to fully elucidate the biological significance and therapeutic potential of xkr6.

What methodological innovations might advance xkr6 research?

To advance xkr6 research, several methodological innovations show particular promise:

  • Advanced Protein Engineering:

    • Development of fluorescently tagged xkr6 variants for live-cell imaging

    • Creation of domain-specific antibodies to study protein localization and function

    • Engineering of conditionally active xkr6 proteins for temporal control of function

  • High-Throughput Phenotyping:

    • Implementation of automated lipid profiling in model systems with xkr6 variants

    • Development of cell-based assays for rapid screening of xkr6 modulators

    • Multi-omics approaches to characterize system-wide effects of xkr6 perturbation

  • Improved Experimental Design Frameworks:

    • Application of adaptive experimental designs that optimize resource allocation

    • Development of integrated contradiction detection systems for real-time literature monitoring

    • Implementation of open science practices to enhance reproducibility and transparency

  • Advanced Statistical and Computational Methods:

    • Machine learning approaches to predict functional consequences of xkr6 variants

    • Network-based methods to contextualize xkr6 function within biological pathways

    • Bayesian frameworks for integrating diverse evidence types

  • Novel Model Systems:

    • Development of xkr6 engineered organoids to study tissue-specific effects

    • Creation of humanized fish models incorporating human xkr6 variants

    • Application of induced pluripotent stem cell (iPSC) technology to study variant effects in human cellular contexts

These methodological innovations, when applied to the study of xkr6, have the potential to significantly accelerate progress in understanding this protein's role in lipid metabolism, apoptosis, and disease pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.