Recombinant Tetraspanin-1 (tsp-1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing it for you.
Synonyms
tsp-1; C02F5.8; Tetraspanin-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
tsp-1
Target Protein Sequence
MATWKFIIRSVLFFLDLAMLLAALALIAVGFWMGYDSSFDTDLKNVIYKYDDPKSLADAK FNIRVWLIVVFWSIIGLSLGAVVTAVLGMISSVWPKRKGFMITYLVLIIVLVSLEIGCGV AVLVRRNSLHDNTNSLIDAMYTTNSVNDLKIIQDKYNCCGIENSLFNVMYCGPMSQKPHC DVAVFDSVDNTMMISGIILLVILILQTIAIILPVPILISRKKTYKYSYEPRVTQLADITE DTRF
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_C02F5.8

STRING: 6239.C02F5.8

UniGene: Cel.9955

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Tetraspanin-1 and what is its basic structure?

Tetraspanin-1 (TSPAN1) is a member of the tetraspanin superfamily, characterized by four transmembrane domains with two different extracellular domains. The protein contains 241 amino acids in humans with a molecular mass ranging from 20-30 kDa. The distinct structural hallmark includes:

  • Four highly hydrophobic transmembrane domains (TM1-TM4)

  • Two extracellular loops (SEL and LEL) with the large extracellular domain (EC2) being particularly important for function

  • One intracellular loop (IL)

  • Short cytoplasmic N- and C-terminal portions

Recombinant TSPAN1 properties typically include:

  • Subcellular location: Membrane

  • Predicted isoelectric point: 5.0

  • Predicted molecular mass: 15.5kDa

  • Accurate molecular mass under SDS-PAGE reducing conditions: 16kDa

How does TSPAN1 function within the tetraspanin family?

TSPAN1 functions similarly to other tetraspanins by organizing tetraspanin-enriched microdomains (TEMs) in cellular membranes. These microdomains serve as molecular scaffolds that:

  • Organize and distribute proteins into highly organized structures

  • Contain adhesion, signaling, and adaptor proteins

  • Modulate cellular signaling, adhesion, fusion, and proliferation

  • Act as platforms for protein-protein interactions

TSPAN1 was identified in 1998 as a tetraspanin 4 superfamily member (transmembrane 4 superfamily) . It belongs to the broader tetraspanin family that includes over 33 members in humans, with CD9, CD63, CD81, and CD151 being among the most extensively studied .

What techniques are recommended for confirming TSPAN1 expression in experimental settings?

Based on published methodologies, researchers should employ multiple techniques to confirm TSPAN1 expression:

  • Quantitative RT-PCR (qRT-PCR):

    • Recommended primers for human TSPAN1:

      • Forward: 5′-TGGGCTGCTATGGTGCTA-3′

      • Reverse: 5′-TGCAGGTTTCATTGGCTGT-3′

    • GAPDH as control:

      • Forward: 5′-CGAGATCCCTCCAAAATCAA-3′

      • Reverse: 5′-TTCACACCCATGACGAACAT-3′

  • Western Blot Analysis:

    • Prepare samples by lysing for 30 min in CytoBuster Protein Extraction Buffer

    • Centrifuge at 12,000 rpm and collect supernatant

    • Use 50 μg protein for 10% SDS-PAGE

    • Transfer to nitrocellulose membrane

    • Block with TBST containing 5% non-fat milk powder

    • Incubate with anti-TSPAN1 antibodies and anti-GAPDH (1:500) as control

    • Visualize using ECL technique

  • Immunohistochemistry:

    • Used to determine subcellular localization

    • TSPAN1 typically shows cytoplasmic expression patterns in cells

How is TSPAN1 involved in cancer progression and what experimental models best demonstrate this?

TSPAN1 has been implicated in various cancer types, with significant overexpression documented in:

  • Breast cancer

  • Cervical cancer

  • Colorectal cancer

  • Esophageal cancer

  • Liver cancer

  • Lung cancer

  • Ovarian cancer

  • Pancreatic cancer

  • Prostate cancer

  • Gastric cancer

  • Nasopharyngeal cancer

Research models demonstrating TSPAN1's role in cancer:

Pancreatic Cancer Model:
Research findings show TSPAN1 involvement in:

  • Cell survival and proliferation

  • Carcinogenesis

  • Reduced apoptosis

The siRNA knockdown experiments in pancreatic cancer cell lines (AsPC-1 and PANC-1) demonstrated that:

  • Silencing TSPAN1 significantly reduced cell proliferation

  • Transfection with Tspan1-siRNA induced >60% decrease in TSPAN1 expression

  • Knockdown significantly increased apoptosis rates in cancer cells but not in normal hTERT-HPNE cells

  • TSPAN1 immunopositive staining correlated with lymph node metastasis, pTNM stages and poor prognosis

What are the methodological considerations when using RNA interference to study TSPAN1 function?

When using siRNA to target TSPAN1, researchers should consider:

  • Design of siRNA sequences:

    • Multiple siRNA sequences should be tested (e.g., si-1, si-2, si-3)

    • Confirmation of knockdown efficiency for each construct is essential

    • In published studies, Tspan1-si-2 achieved highest knockdown efficiency in both AsPC-1 and PANC-1 cells

  • Transfection controls:

    • Empty vector controls must be included (e.g., AsPC-1-Empty, PANC-1-Empty)

    • Non-targeting siRNA controls

    • Normal cell line controls (e.g., hTERT-HPNE cells)

  • Validation of knockdown:

    • qRT-PCR for mRNA level confirmation

    • Western blot for protein level confirmation

    • Quantification of relative protein levels with proper normalization to housekeeping genes

  • Functional assays following knockdown:

    • Cell proliferation (MTT assay)

    • Apoptosis assays (propidium iodide and Annexin V-FITC flow cytometry)

    • Migration and invasion assays (Transwell assays)

How does TSPAN1 interact with viral infection mechanisms and what implications does this have for antiviral research?

While research on TSPAN1-specific viral interactions is limited, tetraspanins as a family have established roles in viral infections:

  • Viral attachment and entry:

    • Tetraspanins organize membrane microdomains that can serve as platforms for viral entry

    • The large extracellular domain (EC2) of tetraspanins is exploited by viruses for cell entry

  • Intracellular trafficking:

    • Perturbations of tetraspanins affect viral intracellular trafficking, translation, assembly, and release

  • Antiviral research applications:

    • Recombinant soluble forms of tetraspanin EC2 domains (including CD9, CD63, CD81, and CD151) produced as fusion proteins can inhibit viral infection

    • These proteins have demonstrated potent inhibition of both R5 and X4 HIV-1 virus infection in macrophages

    • The mechanism appears to be mediated through interference with virus entry

Research suggests targeting tetraspanins may provide a platform for novel therapeutic approaches against viral diseases, particularly arthropod-borne flaviviral diseases .

What are the optimal conditions for expressing and purifying recombinant TSPAN1?

Based on published protocols for recombinant TSPAN1:

Expression System:

  • Prokaryotic expression in E. coli is commonly used

  • For human TSPAN1, residues Thr112~Val215 have been successfully expressed

  • N-terminal His Tag is typically employed for purification

Buffer Formulation:

  • PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose

  • Original concentration: 200μg/mL

Reconstitution:

  • Reconstitute in 10mM PBS (pH 7.4) to a concentration of 0.1-1.0 mg/mL

  • Do not vortex to avoid protein denaturation

Storage Conditions:

  • Avoid repeated freeze/thaw cycles

  • Store at 2-8°C for one month

  • For long-term storage, aliquot and store at -80°C for up to 12 months

Stability Considerations:

  • Thermal stability can be assessed by accelerated thermal degradation test

  • Incubate protein at 37°C for 48h and observe for degradation

  • Loss rate should be less than 5% within expiration date under appropriate storage

What functional assays are most informative when studying TSPAN1's role in cancer cells?

Based on published research, the following assays provide valuable insights into TSPAN1 function:

  • Proliferation Assays:

    • MTT Assay:

      • Plate cells at 5×10³ cells/ml in 200 μl medium/well

      • After 24-96h incubation, add 20 μl of 5 mg/ml MTT

      • Incubate at 37°C for 4h

      • Remove medium and add 150 μl DMSO

      • Measure optical density at 490 nm

  • Apoptosis Assays:

    • Flow Cytometry with PI and Annexin V-FITC:

      • Culture 1×10⁶ cells/well in 6-well plates without FBS for 48h

      • Detach with 0.25% trypsin without EDTA

      • Harvest in complete medium and centrifuge

      • Stain with 50 μg/ml PI and Annexin V-FITC

      • Analyze by flow cytometry

  • Migration and Invasion Assays:

    • Transwell Assays: To evaluate TSPAN1's effect on cell motility and invasive capability

  • Signaling Pathway Analysis:

    • Western blotting for pathway components

    • Phosphorylation state analysis

  • In vivo tumor models:

    • Xenograft models comparing TSPAN1-knockdown cells with controls

    • Assessment of tumor growth, metastasis, and host survival

How can researchers effectively target TSPAN1 for therapeutic development?

Several approaches have proven effective for targeting tetraspanins that could be applied to TSPAN1:

  • Monoclonal Antibodies:

    • Demonstrated efficacy against several tetraspanins including CD151

    • Can target the large extracellular loop (LEL) to disrupt protein-protein interactions

    • May be conjugated with radioisotopes for targeted therapy

  • Soluble Large Extracellular Loop (sLEL) Proteins:

    • Recombinant soluble LEL domains can competitively inhibit tetraspanin function

    • Have shown efficacy in blocking viral infections

  • RNA Interference:

    • siRNA and shRNA approaches have demonstrated efficacy

    • Multiple targeting sequences should be tested to identify optimal knockdown

  • Small Molecule Inhibitors:

    • Targeting of tetraspanin-enriched microdomains (TEMs)

    • May disrupt the cholesterol-tetraspanin interactions

Targeting ApproachEvidenceApplicationsReference
Monoclonal antibodiesDemonstrated for CD37, CD151B-cell leukemia, tumor metastasis
soluble LEL proteinsTested for CD9, CD63, CD81, CD151HIV-1 infection
RNA interferenceDemonstrated for TSPAN1 in PCCPancreatic cancer
Knockout modelsFor various tetraspaninsFunctional validation

How should researchers interpret contradictory findings regarding TSPAN1's role in different cellular contexts?

Contradictory findings regarding TSPAN1 and other tetraspanins can be approached methodically:

  • Consider tissue/cell type specificity:

    • Tetraspanins may have context-dependent functions

    • For example, CD151 knockdown has opposite effects on RhoA activation in different cell types

    • In breast cancer cells, CD151 loss increased RhoA activation

    • In human dermal microvascular endothelial cells, CD151 knockdown also increased RhoA-GTP

  • Evaluate methodological differences:

    • Detection methods have varying sensitivities

    • FRET biosensors can detect <5% changes in small GTPase activity that might be missed by protein pull-down assays

  • Analyze protein interaction networks:

    • Tetraspanins function through complex interaction networks

    • Different partners may be present in different cell types

    • Interaction with other tetraspanins (CD9, CD81) may alter function

  • Consider signaling pathway cross-talk:

    • Examine whether contradictions arise from pathway interactions

    • Determine if observed effects are direct or indirect

What are the most important controls to include when studying TSPAN1 in disease models?

Critical controls for TSPAN1 research include:

  • Expression Analysis Controls:

    • Matched adjacent normal tissues from the same patients

    • Normal cell line counterparts (e.g., hTERT-HPNE for pancreatic cells)

    • Housekeeping genes (GAPDH) for normalization in qPCR and Western blots

  • Genetic Manipulation Controls:

    • Empty vector controls for transfection experiments

    • Multiple siRNA sequences targeting different regions of TSPAN1

    • Non-targeting siRNA with similar GC content

    • Rescue experiments with siRNA-resistant TSPAN1 constructs

  • Functional Assay Controls:

    • Positive and negative controls for each assay

    • Time-point controls to account for temporal variations

    • Dose-response relationships for treatments

  • Species-Specific Considerations:

    • When using animal models, consider species differences in TSPAN1 sequence and function

    • Validate antibodies and reagents for cross-species reactivity

How can researchers distinguish between TSPAN1-specific effects and general tetraspanin family functions?

To differentiate TSPAN1-specific effects from general tetraspanin functions:

  • Comparative Analysis:

    • Study multiple tetraspanins in parallel (e.g., CD9, CD63, CD81, CD151)

    • For example, G protein subunits Gα11, Gαq, and Gβ associate with CD81 but not with CD63 or CD151

  • Domain-Specific Manipulation:

    • Target specific domains unique to TSPAN1

    • Create chimeric proteins switching domains between tetraspanins

    • Site-directed mutagenesis of TSPAN1-specific residues

  • Partner Protein Analysis:

    • Identify and validate TSPAN1-specific binding partners

    • Compare interaction networks between different tetraspanins

    • Use proximity ligation assays to confirm direct interactions

  • Subcellular Localization:

    • Compare localization patterns of different tetraspanins

    • TSPAN1 shows cytoplasmic expression patterns in cancer cells

    • Other tetraspanins may have distinct localization patterns

  • Functional Redundancy Testing:

    • Combine knockdown of multiple tetraspanins

    • Rescue experiments using different tetraspanin family members

What emerging technologies hold promise for advancing TSPAN1 research?

Several cutting-edge technologies could significantly advance TSPAN1 research:

  • CRISPR-Cas9 Genome Editing:

    • Generation of TSPAN1 knockout cell lines and animal models

    • Precise editing of specific domains to determine structure-function relationships

    • Knock-in of tagged versions for live imaging

  • Cryo-Electron Microscopy:

    • Determination of high-resolution structures of TSPAN1 in membrane environments

    • Visualization of TSPAN1-containing tetraspanin-enriched microdomains (TEMs)

    • Structural analysis of TSPAN1 complexes with partner proteins

  • Single-Cell Technologies:

    • Single-cell RNA-seq to identify cell populations with distinctive TSPAN1 expression

    • Single-cell proteomics to map TSPAN1 protein interactions at the individual cell level

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to visualize TSPAN1 distribution in TEMs

    • Live-cell imaging to track TSPAN1 dynamics

    • FRET/BRET approaches to study protein-protein interactions in real-time

  • Exosome/Extracellular Vesicle Analysis:

    • Role of TSPAN1 in exosome biology and intercellular communication

    • Potential as biomarkers in liquid biopsies

What are the most promising therapeutic applications for targeting TSPAN1?

Based on current research, promising therapeutic applications include:

  • Cancer Therapy:

    • TSPAN1 is overexpressed in numerous cancers and correlates with poor prognosis

    • Targeting TSPAN1 induced significant decline in proliferative capacity and increased apoptosis in pancreatic cancer cells

    • Could be particularly effective against pancreatic, gastric, colorectal, and other TSPAN1-overexpressing cancers

  • Combination Therapy Approaches:

    • Combining TSPAN1 targeting with chemotherapy

    • Dual targeting of TSPAN1 and its partner proteins

    • Potential synergy with immune checkpoint inhibitors

  • Diagnostic Applications:

    • TSPAN1 as a biomarker for cancer diagnosis and prognosis

    • Detection in tissue samples and potentially in circulation

    • Monitoring treatment response

  • Delivery Systems:

    • Utilizing knowledge of TSPAN1 in exosome biology for drug delivery

    • Targeted delivery to TSPAN1-overexpressing cells

  • Antiviral Applications:

    • Based on the role of tetraspanins in viral infections

    • Development of broad-spectrum antiviral approaches targeting tetraspanin-mediated entry

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.