Recombinant Thalassiosira pseudonana Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

Importance of Cytochrome f

Cytochrome f, a subunit of the cytochrome b6f complex, mediates electron transfer between photosystem II and photosystem I . This complex is embedded in the thylakoid membranes of chloroplasts (or the equivalent in algae) and plays a vital role in establishing the proton gradient that drives ATP synthesis .

Thalassiosira pseudonana as a Model Organism

Thalassiosira pseudonana is a widely used model organism for studying diatom biology due to several factors :

  • It was the first diatom to have its genome sequenced, making it a valuable resource for genetic and metabolic studies .

  • T. pseudonana is amenable to genetic manipulation, including gene editing using CRISPR-Cas systems, which facilitates functional genomics research .

  • It has significant biotechnological potential, including the ability to synthesize valuable compounds like fucoxanthin and store lipids, including omega-3 fatty acids .

Recombinant Production

Recombinant T. pseudonana apocytochrome f (petA) can be produced in various heterologous hosts, such as Escherichia coli, yeast, or other algal species . The apocytochrome f lacks the heme cofactor, which is typically added post-translationally to form the functional cytochrome f .

Research Applications

Recombinant T. pseudonana apocytochrome f and the petA gene are valuable tools in several research areas:

Gene Replacement by CRISPR/Cas

CRISPR/Cas systems enable targeted genome editing in various plant and algal species, including the model diatom Thalassiosira pseudonana . CRISPR/Cas constructs can induce homologous recombination (HR) in T. pseudonana, generating substitution of genes by a resistance cassette . Efficient gene targeting by HR makes T. pseudonana genetically tractable, advancing functional diatom biology, bionanotechnology, and biotechnological applications aimed at harnessing the metabolic potential of diatoms .

Diel Transcriptional Oscillations

Diel transcriptional oscillations of a plastid antiporter reflect the shift in the resilience of a coastal and centric model diatom Thalassiosira pseudonana under elevated CO$$_2$$ . Transcriptome analysis has discovered the transcriptional modulation of a putative antiporter that might play an essential role in pH homeostasis during the transition between day and night under elevated CO$$_2$$ .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for prioritized development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
31-314
Protein Length
full length protein
Species
Thalassiosira pseudonana (Marine diatom) (Cyclotella nana)
Target Names
petA
Target Protein Sequence
YPVFAQQGYSNPRAANGKLACANCHLNQKAIEIEAPQGVLPNSVFEIEIKVPYDVNRQQI SADGKPADLNVGGILILPKGFKLASKTQISPEVKAKNKGVFISPYSTEFDNILVVGPIAG KTHQELIFPVVAPDPENNPDVKYLTYPFYAGGNRGRGQVYPTGERSNINSFGATQGGQIT EITTTEKGESKITIVNSDGATTSQTLSAGLKLLVKQGDIVKQDQPLNIDPNVGGFGQEES EIVLQSSSRILGYLAFCFCLLLTQVLLVLKKKQYEKVQAAELNF
Uniprot No.

Target Background

Function
Recombinant Thalassiosira pseudonana Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) in Thalassiosira pseudonana?

Apocytochrome f is a protein encoded by the petA gene located in the chloroplast genome of Thalassiosira pseudonana. It serves as a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain. The mature protein (A0T0R9) spans amino acids 31-314 and includes specific binding domains essential for electron transfer . The precursor form (apocytochrome) lacks the heme group that is subsequently attached to form the functional cytochrome f protein. Thalassiosira pseudonana, as a model centric diatom found in oceanic waters, has had its nuclear, mitochondrial, and plastid genomes fully sequenced, enabling detailed studies of genes like petA .

How does T. pseudonana's genomic organization impact recombinant petA expression?

Thalassiosira pseudonana has unique genomic features that directly impact recombinant protein expression strategies. Its mitochondrial genome is compact (~44 kbp) with a relatively small repeat region (~5 kbp) compared to other diatoms like Phaeodactylum tricornutum . More significantly, T. pseudonana's mitochondrial genome uses an alternative genetic code where the typical stop codon UGA encodes tryptophan instead . This alternative codon usage requires careful consideration when designing expression systems in heterologous hosts like E. coli, as standard expression vectors may prematurely terminate translation at UGA codons that should encode tryptophan. For chloroplast-encoded genes like petA, researchers must account for potential codon bias differences between the diatom chloroplast and bacterial expression systems.

What cultivation conditions are optimal for native T. pseudonana prior to molecular studies?

For reliable experimental work with T. pseudonana, consistent cultivation conditions are essential. Based on established protocols, T. pseudonana (CCAP 1085/12) should be grown in synthetic seawater (L1 medium) supplemented with 200 μM of sodium silicate (Na₂SiO₃·9H₂O) at 18°C . Lighting should be provided by cool white fluorescent lights (75 μE m⁻² s⁻¹) with a photoperiod of 16 hours light and 8 hours dark . These specific conditions ensure optimal growth and consistent gene expression patterns, which is critical when studying genes like petA. Researchers should monitor growth rates and culture purity regularly to ensure experimental reproducibility before proceeding to molecular or biochemical analyses.

What methods are recommended for cloning the petA gene from T. pseudonana?

For successful cloning of the petA gene from T. pseudonana, a PCR-based approach with carefully designed primers is recommended. Based on established protocols for similar genes, researchers should:

  • Design primers with 40-60bp length that include 20bp complementary to the target sequence plus additional overlapping homology regions (80-635bp) to facilitate efficient yeast assembly .

  • Perform PCR amplification using a high-fidelity polymerase such as PrimeSTAR GXL with optimized cycling conditions:

    • Initial denaturation at 98°C

    • 25-30 cycles of: denaturation at 98°C for 10s, annealing at 50-60°C for 15s, extension at 68°C (1 min/kb)

    • Final extension at 68°C for 10 min

  • Verify amplification by agarose gel electrophoresis (1.4% agarose)

  • If using plasmid templates, treat PCR products with DpnI to eliminate template DNA

  • Assemble fragments in S. cerevisiae using homologous recombination or in E. coli using Gibson Assembly

The differing G+C content of T. pseudonana (30%) compared to other organisms may necessitate optimization of PCR conditions, particularly annealing temperatures and extension times .

How should researchers express recombinant T. pseudonana Apocytochrome f in E. coli?

Expression of functional recombinant T. pseudonana Apocytochrome f in E. coli requires careful optimization to address several challenges:

  • Vector selection: Use expression vectors with appropriate promoters (T7 is commonly effective) and N-terminal His-tag for purification purposes .

  • Codon optimization: Consider synthesizing a codon-optimized version of the gene to account for the different codon usage between T. pseudonana and E. coli, particularly addressing the alternative genetic code where UGA codes for tryptophan instead of stop .

  • Expression conditions: A recommended protocol includes:

    • Transform expression plasmid into BL21(DE3) or Rosetta(DE3) E. coli strains

    • Culture in LB medium with appropriate antibiotics at 37°C until OD₆₀₀ reaches 0.6-0.8

    • Induce with 0.1-1.0 mM IPTG

    • Lower temperature to 16-20°C for overnight expression to enhance proper folding

    • Harvest cells by centrifugation at 4,000×g for 20 minutes at 4°C

  • Protein extraction and purification:

    • Lyse cells using sonication or commercial lysis buffers containing DNase

    • Purify using Ni-NTA affinity chromatography under native conditions

    • Further purify using size exclusion chromatography if necessary

    • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0 and add glycerol (final concentration 5-50%) for long-term storage at -20°C/-80°C

This methodology has been successfully applied to produce full-length (amino acids 31-314) Apocytochrome f with N-terminal His-tag, resulting in purities greater than 90% as determined by SDS-PAGE .

What are the critical steps for verifying recombinant Apocytochrome f identity and functionality?

Verification of recombinant Apocytochrome f requires several analytical techniques:

  • Identity and purity analysis:

    • SDS-PAGE to confirm molecular weight (expect approximately 32-34 kDa including the His-tag)

    • Western blot using anti-His antibodies or specific antibodies against Apocytochrome f

    • Mass spectrometry for accurate molecular weight determination and sequence confirmation

  • Structural verification:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

    • Fluorescence spectroscopy to analyze tertiary structure integrity

  • Functional analysis:

    • Cytochrome c reduction assay to verify electron transfer capability

    • Reconstitution with heme group (to convert apocytochrome to holocytochrome)

    • Binding studies with interaction partners from the cytochrome b6f complex

  • Storage stability assessment:

    • Analyze protein after storage at different conditions (avoid repeated freeze-thaw cycles)

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol for optimal stability

These verification steps ensure that the recombinant protein maintains structural integrity and functional capabilities similar to the native protein.

How can researchers utilize T. pseudonana's organelle genome cloning systems for petA studies?

The established methodology for cloning T. pseudonana's mitochondrial genome in yeast and E. coli provides a valuable platform for studying chloroplast genes like petA. Researchers can apply this approach with the following modifications:

  • Design strategy: Create a cloning design that captures the petA gene within its genomic context by:

    • Amplifying the region as multiple overlapping fragments (8-12 fragments depending on size)

    • Including appropriate selection markers (URA3 for yeast selection)

    • Adding compatible vector backbones like pPtGE31 or pAGE3.0 that contain elements for selection and stable propagation

  • Host selection: Consider stability differences between hosts:

    • S. cerevisiae provides excellent stability for cloning large DNA fragments

    • E. coli may show instability with T. pseudonana sequences (17% contained deletions after 60 generations)

  • Genome engineering approaches: Use the cloned sequences to:

    • Perform site-directed mutagenesis to study specific petA residues

    • Create fusion constructs for localization studies

    • Develop targeted knockout or replacement strategies

    • Test polycistronic expression units in the chloroplast context

This approach leverages the advantages of organelle genome engineering, including polycistronic gene organization, lack of transgene silencing, reduced positional effects, and compartmentalization of biosynthetic pathways .

What comparative analyses can reveal insights about T. pseudonana Apocytochrome f evolution?

Comparative analysis of T. pseudonana Apocytochrome f with homologs from other photosynthetic organisms can provide valuable evolutionary insights:

Organism TypeG+C ContentNotable FeaturesEvolutionary Implications
T. pseudonana (diatom)30%Alternative genetic code (UGA→Trp)Unique adaptation to marine environment
P. tricornutum (diatom)35%Larger repeat regionsDifferent evolutionary pressures within diatoms
Green algaeVariableStandard genetic codeDivergent evolution after endosymbiosis
Land plantsHigherConserved functional domainsSelective pressure on core function

Research approaches should include:

  • Multiple sequence alignment of Apocytochrome f sequences across diverse photosynthetic lineages

  • Analysis of selection pressure on different domains of the protein

  • Structural modeling to identify conserved functional regions versus variable regions

  • Correlation between sequence variations and ecological niches

These analyses can reveal how evolutionary pressures shaped photosynthetic electron transport components in different lineages, particularly in response to the unique environmental challenges faced by marine diatoms like T. pseudonana .

How does the alternative genetic code in T. pseudonana impact heterologous expression systems?

The alternative genetic code in T. pseudonana's mitochondrial genome, where UGA codes for tryptophan instead of serving as a stop codon, presents several challenges and opportunities for researchers:

  • Expression challenges:

    • Standard E. coli expression will interpret UGA as a stop codon, causing premature termination

    • The lower G+C content (30%) may lead to suboptimal codon usage in E. coli

  • Mitigation strategies:

    • Use specialized E. coli strains containing rare tRNA genes (e.g., Rosetta strains)

    • Perform codon optimization by replacing UGA codons with UGG (standard tryptophan codon)

    • Utilize a synthetic gene approach rather than direct amplification from genomic DNA

  • Experimental advantages:

    • The alternative genetic code can serve as a natural biocontainment mechanism

    • It enables the development of selection markers that only function when delivered to the mitochondrial compartment, eliminating the need to screen against nuclear transformants

  • Systematic approach:

    • Identify all UGA codons in the target gene sequence

    • Evaluate their positions relative to critical functional domains

    • Design a codon optimization strategy that preserves amino acid sequence while maximizing expression

    • Test expression in parallel with both native and optimized sequences

Understanding these genetic code variations is essential when designing heterologous expression systems for T. pseudonana genes in general, and specifically for petA studies .

What are common challenges in T. pseudonana recombinant protein expression and their solutions?

Researchers frequently encounter several challenges when working with recombinant proteins from T. pseudonana:

  • Genomic instability in E. coli:

    • Problem: Approximately 17% of cloned T. pseudonana mitochondrial genomes develop deletions after 60 generations in E. coli

    • Solution: Minimize propagation time in E. coli; use low copy number plasmids; verify sequence integrity regularly; consider yeast as a more stable cloning host

  • Expression toxicity:

    • Problem: Lower end-point densities observed in E. coli cultures expressing T. pseudonana genes at high copy numbers

    • Solution: Use tightly regulated promoters; reduce induction levels; switch to low-copy vectors; optimize growth media composition

  • Protein solubility issues:

    • Problem: Membrane-associated proteins like Apocytochrome f often form inclusion bodies

    • Solution: Express at lower temperatures (16-20°C); add solubility-enhancing fusion tags; optimize buffer conditions; consider refolding protocols

  • Functional reconstitution:

    • Problem: Recombinant Apocytochrome f requires heme incorporation for full functionality

    • Solution: Develop in vitro heme incorporation protocols; co-express heme biosynthesis genes; verify spectroscopic properties

Addressing these challenges requires a systematic approach to optimization at each step of the expression and purification process.

How should researchers interpret contradictory results in T. pseudonana studies?

When researchers encounter contradictory results in T. pseudonana studies, particularly regarding Apocytochrome f, a methodical troubleshooting approach is essential:

By systematically evaluating these variables, researchers can identify the source of contradictions and develop standardized protocols that enhance reproducibility across different laboratories.

What emerging technologies could enhance T. pseudonana Apocytochrome f research?

Several cutting-edge technologies show promise for advancing research on T. pseudonana Apocytochrome f:

  • CRISPR/Cas9 genome editing:

    • Direct modification of the native petA gene in T. pseudonana

    • Introduction of reporter fusions at the endogenous locus

    • Precise engineering of specific residues to test functional hypotheses

  • Single-cell omics:

    • Analysis of petA expression variability within populations

    • Correlation of expression with cellular physiology

    • Integration with metabolomics to understand functional impacts

  • Advanced structural biology:

    • Cryo-EM structures of the entire cytochrome b6f complex from T. pseudonana

    • Time-resolved crystallography to capture electron transfer dynamics

    • Molecular dynamics simulations to understand species-specific adaptations

  • Synthetic biology approaches:

    • Development of T. pseudonana as a chassis for synthetic photosynthetic systems

    • Engineering of enhanced electron transport chains

    • Creation of minimal photosynthetic modules for biotechnological applications

  • Environmental adaptation studies:

    • Analysis of petA performance under varying CO2 concentrations (similar to studies showing D. salina can tolerate up to 30% CO2)

    • Investigation of temperature and pH adaptations specific to oceanic environments

These emerging technologies could provide unprecedented insights into the structure, function, and evolution of this key photosynthetic component.

How might T. pseudonana Apocytochrome f research contribute to climate change mitigation strategies?

Research on T. pseudonana Apocytochrome f has potential applications in climate change mitigation through several pathways:

  • Enhanced carbon fixation:

    • Understanding and optimizing the electron transport chain could lead to diatoms with improved photosynthetic efficiency

    • Engineered strains could potentially capture more atmospheric CO2, as diatoms already play a significant role in global carbon cycling

  • Algal biofuel production:

    • Optimized photosynthetic electron transport could enhance biomass production

    • Improved understanding of energy conversion efficiency might lead to strains with higher lipid production for biofuel applications

  • Adaptation to changing ocean conditions:

    • Research into how Apocytochrome f functions under varying pH, temperature, and CO2 conditions could predict adaptation capabilities

    • This knowledge could help forecast effects of ocean acidification on marine primary productivity

  • Biotechnological applications:

    • T. pseudonana's silica frustule encasement is suitable for nanotechnologies and drug delivery systems

    • Integration of engineered photosynthetic components with nanotechnology could lead to novel CO2 capture systems

  • Fundamental knowledge contribution:

    • Better understanding of diatom photosynthesis enhances global carbon cycle models

    • Identification of unique adaptations in marine photosynthetic organisms provides insights into evolutionary responses to climate change

By advancing our understanding of this key photosynthetic component in an ecologically important marine diatom, researchers contribute to both fundamental knowledge and applied solutions for climate change challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.