Recombinant Thalassiosira pseudonana ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Thalassiosira pseudonana (Marine diatom) (Cyclotella nana)
Target Names
atpF
Target Protein Sequence
MENFNQIFTVLAASEGIGLNLDILETGLLNILALVAILVYTGKDFLGSILQERKSTIVKS VQDAEDRLNEANRRLSEAQKQLSQAHVVISEIRNETKTAKTNLLKSDATTAKKELTTRFN RAISSFRSKERVIFLDVKQQIISLVLKRSAIQAKETFGSKKRARALINETIQKLEGDLL
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core; and the F0 domain, containing the membrane proton channel. These domains are connected by a central and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Thalassiosira pseudonana and why is it significant as a model organism?

Thalassiosira pseudonana is a centric diatom species with a diameter ranging from 2.5-15 μm that has become an important model organism for molecular biology studies. This diatom is significant due to its fully sequenced genome, ease of cultivation, and importance in marine ecosystems. It reproduces both sexually and asexually, with reproduction rates increasing at higher temperatures. The organism possesses a dormant stage that is likely a physiological resting cell, triggered by temperature and light cues, which could provide competitive advantages in natural environments . As a model organism, T. pseudonana offers valuable insights into silica biomineralization processes and has been used extensively for genetic modification studies, including the recent application of CRISPR/Cas genome editing techniques .

What are the optimal growth conditions for T. pseudonana in laboratory settings?

For laboratory cultivation of T. pseudonana (CCMP 1335), researchers typically use half-salinity Aquil sea water medium (16 g/l) supplemented with silica. The optimal growth conditions include constant illumination at approximately 100 μmol photons m^-2 s^-1 and a temperature of 20°C . Growth can be limited by various factors including concentrations of vitamin B-12, silicon, selenium, zinc, nitrogen, phosphorus, or other vitamins . The organism grows well in pH ranges of 7-8.8, with reduced growth rates at higher pH values due to CO2 limitations. It is capable of quickly adapting to changes in irradiance by adjusting cell volume to optimize photosynthetic efficiency .

What is the function of ATP synthase subunit b (atpF) in the chloroplast?

The ATP synthase subunit b (atpF) is a crucial component of the chloroplastic ATP synthase complex in T. pseudonana. This protein plays a structural role in the F₀ portion of the ATP synthase, anchoring the complex to the thylakoid membrane and helping form the peripheral stalk that connects the F₁ and F₀ portions of the enzyme. As part of the ATP synthase complex, atpF contributes to the conversion of the proton gradient established during photosynthesis into ATP through oxidative phosphorylation, making it essential for energy metabolism in the chloroplast of T. pseudonana.

What are effective strategies for cloning the atpF gene from T. pseudonana?

For efficient cloning of the atpF gene from T. pseudonana, researchers should consider PCR amplification of genomic DNA using gene-specific primers with added restriction sites to facilitate directional cloning. Based on successful approaches with other T. pseudonana genes, designing primers with specific restriction sites (such as StuI and HindIII) and adding histidine tags for purification has proven effective . When designing the cloning strategy, it is important to analyze the target sequence for potential repetitive regions, which are common in T. pseudonana genes.

A recommended approach based on successful protocols would include:

  • Design primers with appropriate restriction sites based on the atpF sequence

  • Amplify the gene from T. pseudonana genomic DNA

  • Clone into an appropriate expression vector (e.g., pPROEX-HTb or pET28a)

  • Transform into E. coli DH5α for plasmid propagation

  • Confirm the sequence before proceeding to expression

This approach has been successfully used for other T. pseudonana genes and would likely be applicable to atpF .

What expression systems are most suitable for recombinant atpF production?

For recombinant production of T. pseudonana atpF, E. coli-based expression systems have been successfully used for other diatom proteins. Based on protocols used for other T. pseudonana proteins, the pET28a or pPROEX-HTb vectors with BL21(DE3) E. coli strains would be appropriate choices . For expression optimization, the following parameters have proven effective:

  • Grow transformed E. coli to an optical density (OD₆₀₀) of approximately 0.6

  • Induce protein expression with 1 mM IPTG

  • Continue expression for 3 hours at 37°C

  • Harvest cells by centrifugation and wash with 1% (w/v) NaCl

  • Lyse cells using appropriate buffers containing protease inhibitors

For challenging membrane proteins like atpF, expression conditions might need to be modified, potentially using lower temperatures (15-25°C) and longer induction times to improve proper folding .

How can atpF protein purification be optimized for functional studies?

To optimize the purification of recombinant atpF from T. pseudonana for functional studies, a multi-step purification strategy is recommended. Based on successful approaches with other transmembrane proteins from T. pseudonana, researchers should consider:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin if a His-tag was incorporated into the recombinant protein

  • Ion exchange chromatography as a secondary purification step

  • Size exclusion chromatography for final polishing and buffer exchange

For membrane proteins like atpF, addition of detergents (such as n-dodecyl β-D-maltoside or CHAPS) during extraction and purification is critical to maintain protein stability and functionality. Purification under native conditions should be attempted first, but if yields are low, denaturing conditions with subsequent refolding may be necessary .

How can CRISPR/Cas9 be used to study atpF function in T. pseudonana?

CRISPR/Cas9 technology can be effectively applied to study atpF function in T. pseudonana through targeted gene editing. A recent breakthrough demonstrates highly efficient homologous recombination (HR) in this diatom, making it possible to create precise genetic modifications . For atpF studies, researchers should:

  • Design sgRNAs targeting specific regions of the atpF gene, carefully considering the potential for off-target effects

  • Create a donor matrix (template) containing homologous regions flanking the desired modification

  • Use Golden Gate cloning to assemble plasmids containing Cas9, sgRNA, and the donor matrix

  • Transform T. pseudonana with these constructs using established protocols

  • Screen transformants using antibiotic selection and PCR validation

This approach has shown approximately 85% efficiency in targeting other genes in T. pseudonana and would be applicable to studying atpF function through knockout, knock-in, or point mutation strategies .

What controls should be included when analyzing atpF expression patterns?

When analyzing atpF expression patterns in T. pseudonana, proper experimental controls are essential for meaningful interpretation. Based on successful gene expression studies in T. pseudonana, researchers should include:

  • Reference genes for normalization: Common reference genes include actin, GAPDH, and fucoxanthin chlorophyll a/c binding protein (FCP) genes. Specifically, tpfcp9 has been used successfully as a control gene in T. pseudonana studies .

  • Time-course synchronization: For cell cycle-dependent expression analysis, T. pseudonana cultures should be synchronized, and samples collected at regular intervals to capture expression dynamics .

  • Negative controls: Include non-template controls in PCR reactions and samples from wild-type strains.

  • Positive controls: Include genes with known expression patterns, such as tpsil3, which has been well-characterized in T. pseudonana .

For RT-PCR analysis, 25 cycles of amplification using conditions of 94°C for 20s, 60°C for 20s, and 72°C for 40s has been effective for T. pseudonana gene expression studies .

What approaches are most effective for creating atpF knockouts or mutants?

Creating atpF knockouts or mutants in T. pseudonana can be achieved with high efficiency using CRISPR/Cas-mediated homologous recombination. Based on recent advances, the most effective approach involves:

  • Designing two plasmids:

    • First plasmid containing Cas9 and sgRNA targeting atpF

    • Second plasmid containing a resistance cassette (such as FCP:NAT) flanked by homologous regions to atpF gene

  • Using Golden Gate cloning for plasmid assembly, which allows for efficient single-step restriction/ligation reactions using BsaI (L1 assembly) or BpiI (L2 assembly)

  • Transforming T. pseudonana with both plasmids simultaneously

  • Selecting transformants on media containing the appropriate antibiotic (e.g., nourseothricin)

  • Confirming successful integration using nested PCR and sequencing

This approach has demonstrated approximately 85% efficiency in targeted gene replacement in T. pseudonana, making it a powerful tool for atpF functional studies .

What techniques are most informative for studying ATP synthase complex assembly in T. pseudonana?

For studying ATP synthase complex assembly in T. pseudonana, researchers should employ a combination of structural and functional approaches:

  • Blue-Native PAGE: This technique allows visualization of intact protein complexes and can reveal assembly intermediates when combined with antibodies against atpF or other subunits.

  • Co-immunoprecipitation: Using antibodies against atpF or tagged recombinant versions to pull down interacting partners and identify them by mass spectrometry.

  • Cryo-electron microscopy: For detailed structural characterization of the assembled complex.

  • Fluorescently tagged fusion proteins: Creating fluorescent protein fusions with atpF can allow visualization of complex assembly in vivo using confocal microscopy.

  • Crosslinking studies: Chemical crosslinking combined with mass spectrometry can reveal spatial relationships between subunits within the complex.

These approaches collectively would provide comprehensive insights into how atpF contributes to ATP synthase assembly and function in diatom chloroplasts.

How can researchers differentiate between native and recombinant atpF in experimental systems?

Differentiating between native and recombinant atpF in experimental systems can be achieved through several strategies:

  • Epitope tagging: Adding fusion tags (His, FLAG, etc.) to recombinant atpF enables distinction using tag-specific antibodies. For example, adding an N-terminal or C-terminal hexahistidine tag to recombinant atpF, as has been done with other T. pseudonana proteins .

  • Size differences: Introducing small additions or deletions to the recombinant protein creates size differences detectable by Western blotting.

  • Mass spectrometry: Peptide mass fingerprinting can distinguish recombinant from native proteins based on unique peptide signatures.

  • Immunological methods: Developing antibodies that specifically recognize unique epitopes in the recombinant protein not present in the native form.

  • Expression in heterologous systems: Using chloroplast-free expression systems ensures that any detected atpF must be recombinant.

These approaches are critical for validating experimental systems studying recombinant atpF function and interactions.

What post-translational modifications affect atpF function and how can they be characterized?

Post-translational modifications (PTMs) of atpF can significantly impact its function within the ATP synthase complex. To characterize these modifications:

  • Phosphorylation analysis: Using phospho-specific antibodies or phosphoproteomic approaches to identify phosphorylation sites. Kinase assays using purified protein kinases (similar to those identified in T. pseudonana, such as tpSTK1) can help characterize in vitro phosphorylation .

  • Mass spectrometry: High-resolution MS/MS analysis can identify various PTMs including phosphorylation, acetylation, and methylation.

  • Site-directed mutagenesis: Mutating potential modification sites and assessing functional impacts can reveal the importance of specific PTMs.

  • PTM-specific staining: Techniques like Pro-Q Diamond for phosphoproteins or periodic acid-Schiff staining for glycosylation can be used with purified protein.

Understanding these modifications is crucial as they may regulate atpF assembly into the ATP synthase complex, protein turnover rates, or ATP synthesis activity in response to changing environmental conditions.

What are common challenges in expressing functional recombinant atpF and how can they be addressed?

Researchers commonly encounter several challenges when expressing functional recombinant atpF from T. pseudonana:

  • Low solubility: As a membrane protein, atpF often aggregates or forms inclusion bodies. Strategies to address this include:

    • Using lower induction temperatures (15-20°C)

    • Adding solubility tags (MBP, SUMO, etc.)

    • Including membrane-mimicking detergents during extraction

  • Improper folding: Membrane proteins often misfold in heterologous systems. Solutions include:

    • Co-expressing with molecular chaperones

    • Testing multiple E. coli strains (e.g., C41/C43 designed for membrane proteins)

    • Using cell-free expression systems with lipid nanodiscs

  • Low expression levels: Optimizing codon usage for the expression host and using stronger promoters can help overcome this limitation.

  • Proteolytic degradation: Adding protease inhibitors during purification and designing constructs to minimize exposed protease-susceptible regions can reduce degradation .

  • Loss of function during purification: Maintaining a lipid-like environment throughout purification by using appropriate detergents is critical for preserving function.

Implementing these strategies has improved the expression of other challenging membrane proteins from T. pseudonana and would likely be effective for atpF as well.

How can researchers validate the functionality of recombinant atpF in vitro?

To validate the functionality of recombinant atpF in vitro, researchers should employ multiple complementary approaches:

  • ATP synthase activity assays: Reconstituting purified recombinant atpF with other ATP synthase components and measuring ATP synthesis or hydrolysis activity.

  • Proton translocation assays: Using pH-sensitive fluorescent dyes to monitor proton movement across membranes in reconstituted systems.

  • Binding assays: Confirming proper interaction with other ATP synthase subunits using techniques like surface plasmon resonance or pull-down assays.

  • Structural integrity assessment: Circular dichroism spectroscopy to verify proper secondary structure composition compared to native protein.

  • Reconstitution in liposomes: Incorporating recombinant atpF into artificial membrane systems and assessing its ability to associate with other ATP synthase components.

These functional validation approaches collectively provide strong evidence for proper folding and biological activity of the recombinant protein.

What strategies can resolve data inconsistencies when comparing native and recombinant atpF function?

When researchers encounter inconsistencies between native and recombinant atpF functional data, several systematic troubleshooting approaches can help resolve these discrepancies:

  • Post-translational modification analysis: Compare PTM profiles between native and recombinant proteins using mass spectrometry, as differences may explain functional variations.

  • Lipid environment assessment: Native membranes contain specific lipid compositions that may be critical for proper function; adjusting the lipid composition in recombinant systems may improve functional similarity.

  • Protein complex formation evaluation: Check if recombinant atpF properly assembles with partner proteins using techniques like blue native PAGE or co-immunoprecipitation.

  • Domain-swapping experiments: Create chimeric proteins combining domains from native and recombinant versions to identify regions responsible for functional differences.

  • Temperature and pH sensitivity comparisons: Assess functional parameters under varying conditions to identify potential differences in stability or activity optima.

  • Computational modeling: Use structural predictions to identify potential conformational differences between native and recombinant forms that might explain functional discrepancies.

Through systematic investigation of these factors, researchers can identify and address the underlying causes of functional inconsistencies.

How can atpF research contribute to bioenergy applications involving T. pseudonana?

Research on ATP synthase subunit b (atpF) in T. pseudonana has significant implications for bioenergy applications:

These applications represent promising avenues for translating fundamental atpF research into practical bioenergy solutions.

What insights can comparative genomics provide about atpF evolution in diatoms?

Comparative genomics approaches offer valuable insights into atpF evolution across diatom species:

These comparative approaches can provide a deeper understanding of how this essential component of energy metabolism has evolved in diatoms and how it contributes to their ecological success.

How might future technological developments enhance our ability to study atpF function?

Emerging technologies will likely transform our ability to study atpF function in T. pseudonana:

  • Advanced CRISPR technologies: New developments beyond current CRISPR/Cas9 applications , such as base editing and prime editing, will enable more precise modifications to atpF without disrupting the entire gene, allowing subtle functional studies of specific domains or residues.

  • Cryo-electron tomography: This emerging technique will allow visualization of ATP synthase complexes in their native cellular environment, providing unprecedented insights into how atpF contributes to complex formation and function within the chloroplast membrane.

  • Single-molecule biophysics: Advanced techniques like magnetic tweezers or high-speed atomic force microscopy will enable real-time observation of atpF function within the ATP synthase complex, revealing dynamic conformational changes during the catalytic cycle.

  • Synthetic biology tools: Expanding genetic toolkit for T. pseudonana will allow inducible expression systems, optogenetic control, and other sophisticated regulatory mechanisms to study atpF function under precisely controlled conditions.

  • Artificial intelligence applications: Machine learning approaches will enhance our ability to predict atpF structure-function relationships and identify non-obvious patterns in experimental data, accelerating discovery and hypothesis generation.

These technological advances promise to reveal new aspects of atpF function that remain inaccessible with current methodologies, potentially transforming our understanding of ATP synthase function in diatoms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.