Recombinant Thalassiosira pseudonana ATP synthase subunit b', chloroplastic (atpG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its inclusion.
Synonyms
atpF2; atpG; ATP synthase subunit b', chloroplastic; ATP synthase F(0 sector subunit b'; ATPase subunit II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Thalassiosira pseudonana (Marine diatom) (Cyclotella nana)
Target Names
atpG
Target Protein Sequence
MINLSILISSSEVSGPGGLFDINATLPLVAIQFILLMVTLNIILYSPLLTIIEERKEYVL SHLAQASEKLAQAKELTTQYEQDLETARKEAQLEIANSQNIHKEILDIELDISQKYIDNL LETISSDLLNKKKTALDSLDTIVTSLCTEVETKLSI
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase catalyzes ATP synthesis from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembranous) and the F(0) membrane proton channel, connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled, via a rotary mechanism involving the central stalk subunits, to proton translocation. The b' subunit, a component of the F(0) channel and part of the peripheral stalk, links F(1) to F(0). It represents a divergent, duplicated form of the b subunit found in plants and photosynthetic bacteria.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

How is recombinant Thalassiosira pseudonana atpG typically produced for research purposes?

For research applications, recombinant Thalassiosira pseudonana atpG is typically produced using heterologous expression systems, with E. coli being the most common expression host. The production process involves:

  • Gene cloning: The atpG gene sequence (covering amino acids 1-156) is PCR-amplified from Thalassiosira pseudonana genomic DNA or synthesized based on the known sequence.

  • Vector construction: The gene is cloned into an expression vector with an N-terminal His-tag for purification purposes.

  • Transformation: The recombinant vector is transformed into a suitable E. coli strain.

  • Expression induction: Protein expression is induced under optimized conditions.

  • Cell harvesting and lysis: Bacterial cells are collected and disrupted to release the recombinant protein.

  • Purification: His-tagged atpG is purified using affinity chromatography.

  • Quality control: The purity is verified using SDS-PAGE (typically >90% purity).

  • Lyophilization: The purified protein is freeze-dried to create a stable powder format .

This standardized approach yields research-grade recombinant protein that can be reconstituted in appropriate buffers for experimental use.

What reconstitution and storage protocols are recommended for optimal stability of recombinant atpG?

Proper handling of recombinant atpG is crucial for maintaining its structural integrity and function. Based on established protocols, the following recommendations apply:

Reconstitution Protocol:

  • Centrifuge the vial briefly before opening to bring contents to the bottom.

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) to enhance stability.

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles.

Storage Conditions:

  • Short-term storage (up to one week): 4°C for working aliquots.

  • Long-term storage: -20°C/-80°C in aliquoted format.

  • Storage buffer: Tris/PBS-based buffer containing 6% Trehalose, pH 8.0 .

Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided. Each reconstitution cycle should be carefully documented to track the protein's potential degradation over time.

How does the structure and function of atpG in diatoms differ from other photosynthetic organisms?

Diatoms like Thalassiosira pseudonana possess unique characteristics in their photosynthetic machinery compared to green algae and land plants, reflected in their ATP synthase components including atpG:

Structural Comparisons:

CharacteristicDiatoms (T. pseudonana)Green Algae/Land Plants
Electron TransportLinear electron flow predominant under normal conditionsBoth linear and cyclic electron flow active
ATP Synthase OrganizationDistinct F0 subunit arrangementDifferent subunit stoichiometry
Photosynthetic EfficiencyHigher efficiency in fluctuating lightOptimized for stable light conditions
Gene OverlappingatpF-atpD genes overlap by 4 bp in many speciesLess gene overlapping in general

The unique characteristics of diatom photosynthesis, including ATP synthase structure and function, likely contribute to their ecological success in marine environments where light and nutrient availability fluctuate considerably.

What methodologies can be employed to study protein-protein interactions involving atpG?

Investigating protein-protein interactions involving atpG requires specialized techniques that preserve the native structure and functional relationships. Several complementary approaches can be employed:

In vitro Methods:

  • Co-immunoprecipitation (Co-IP): Using antibodies against atpG or its His-tag to pull down interacting partners.

  • Surface Plasmon Resonance (SPR): For quantitative analysis of binding kinetics between atpG and putative interacting proteins.

  • Isothermal Titration Calorimetry (ITC): To determine thermodynamic parameters of protein interactions.

  • Cross-linking followed by mass spectrometry: To capture transient interactions within the ATP synthase complex.

In silico Methods:

  • Molecular docking and dynamics simulations: Based on the amino acid sequence provided in the product information .

  • Analysis using genome-scale metabolic models: The comprehensive model of T. pseudonana (iThaps987) can provide context for predicting functional interactions .

Functional Methods:

  • Reconstitution studies: Assembling the ATP synthase complex with wild-type or mutant atpG to assess functional implications.

  • Yeast two-hybrid or bacterial two-hybrid systems: For initial screening of potential interacting partners.

When studying membrane proteins like ATP synthase components, particular attention must be paid to maintaining appropriate detergent conditions to preserve native conformations during experimental manipulations.

How can researchers assess the functional integrity of recombinant atpG after purification?

Verifying the functional integrity of recombinant atpG is critical before using it in downstream experiments. Several complementary approaches can be employed:

Structural Integrity Assessment:

  • Circular Dichroism (CD) Spectroscopy: To verify the secondary structure content and folding state.

  • Fluorescence Spectroscopy: To assess tertiary structure through intrinsic tryptophan fluorescence.

  • Limited Proteolysis: To confirm the compact, folded state of the protein.

Functional Assays:

  • ATP Hydrolysis Assay: When integrated into a reconstituted ATP synthase complex.

  • Proton Translocation Measurements: Using pH-sensitive fluorescent dyes in reconstituted liposomes.

  • Binding Assays: With known interacting partners from the ATP synthase complex.

Quality Control Metrics:

  • SDS-PAGE and Western Blot: Confirm size, purity (>90% is standard), and immunoreactivity.

  • Mass Spectrometry: Verify the exact mass and potential post-translational modifications.

  • Dynamic Light Scattering (DLS): Assess oligomeric state and aggregation propensity.

For each batch of recombinant atpG, researchers should establish a standardized quality control workflow that combines at least one method from each category to ensure comprehensive validation before experimental use.

How can recombinant atpG be utilized in studies of diatom photosynthetic efficiency and stress responses?

Recombinant atpG offers unique opportunities for investigating diatom photosynthetic mechanisms and stress responses through several advanced experimental approaches:

Structure-Function Studies:

  • Site-directed mutagenesis: Introducing specific mutations in conserved regions to investigate their impact on ATP synthase assembly and function.

  • Chimeric protein construction: Creating hybrid proteins combining domains from different species to understand evolutionary adaptations in diatom ATP synthase.

Stress Response Investigation:

  • Antibody development: Using recombinant atpG to develop specific antibodies for monitoring expression levels under different environmental stressors.

  • Protein-protein interaction shifts: Examining how interactions between atpG and other components change under various stress conditions.

The genome-scale metabolic model of T. pseudonana (iThaps987) has revealed that under normal phototrophic conditions, this diatom exhibits primarily linear electron flow rather than the combination of linear and cyclic flows seen in green algae and plants . Researchers can use recombinant atpG to investigate how this protein contributes to the unique electron transport characteristics of diatoms through reconstitution experiments with variable subunit compositions.

Additionally, considering T. pseudonana's ability to synthesize valuable compounds like fucoxanthin and store omega-3 fatty acids , researchers can explore correlations between ATP synthase efficiency (mediated by atpG) and the production of these bioactive molecules under different cultivation conditions.

What approaches can be used to integrate atpG research into broader systems biology studies of Thalassiosira pseudonana?

Integrating atpG research into systems biology frameworks requires multidisciplinary approaches that connect molecular-level insights to whole-cell metabolism and ecological function:

Multi-omics Integration:

  • Correlation analysis: Combining proteomics data on atpG expression/modification with transcriptomics and metabolomics datasets.

  • Flux balance analysis: Using the genome-scale metabolic model iThaps987 to predict how perturbations in atpG function affect global metabolic fluxes.

  • Network analysis: Positioning atpG within protein-protein interaction networks to identify its role in coordinating responses to environmental changes.

Model Refinement and Validation:

  • In silico predictions: The iThaps987 model includes 987 genes, 2477 reactions, and 2456 metabolites , providing a framework for predicting the systemic effects of atpG manipulation.

  • Experimental validation: Using recombinant atpG in biochemical assays to validate and refine predictions from the metabolic model.

Comparative Analysis:

  • Cross-species comparison: Comparative analysis with other diatoms like Phaeodactylum tricornutum reveals unique enzymatic capabilities in T. pseudonana, with 183 unique enzymes primarily in amino acid, carbohydrate, and lipid metabolism .

  • Evolutionary studies: Investigating how atpG function relates to the evolutionary adaptations that have made diatoms successful in marine environments.

This systems biology perspective enables researchers to connect molecular details about atpG to broader questions about diatom ecology, evolution, and biotechnological potential.

What methodological considerations are important when designing experiments to investigate atpG role in ATP synthase assembly and function?

Designing rigorous experiments to investigate atpG's role requires careful attention to multiple methodological aspects:

Experimental Design Considerations:

  • Protein stability: Given that repeated freeze-thaw cycles significantly reduce protein activity , experiments should be designed to minimize sample manipulation.

  • Buffer optimization: The standard storage buffer (Tris/PBS-based buffer with 6% Trehalose, pH 8.0) may need modification depending on the specific assay.

  • Membrane protein handling: As a component of a membrane-bound complex, atpG requires appropriate detergents or lipid environments to maintain native conformation.

Controls and Validations:

  • Positive controls: Include well-characterized ATP synthase components from model organisms.

  • Negative controls: Use denatured atpG or irrelevant proteins of similar size/charge.

  • Validation across methods: Confirm findings using orthogonal techniques to avoid method-specific artifacts.

Advanced Techniques for Assembly Studies:

  • Single-molecule FRET: To monitor real-time assembly dynamics of ATP synthase components.

  • Cryo-electron microscopy: For structural analysis of assembled complexes with and without atpG.

  • Native mass spectrometry: To determine subunit stoichiometry and assembly intermediates.

Data Analysis and Interpretation:

  • Statistical rigor: Ensure sufficient biological and technical replicates.

  • Context within metabolic model: Interpret findings within the framework of the iThaps987 genome-scale metabolic model .

  • Cross-validation with genomic data: Compare experimental findings with predictions based on genomic information.

These methodological considerations help ensure that experiments yield reliable, reproducible insights into atpG function within the complex and highly regulated ATP synthase machinery.

What are the current gaps in knowledge regarding atpG function and structure that present opportunities for novel research?

Despite advances in understanding ATP synthase components, several significant knowledge gaps concerning atpG present opportunities for groundbreaking research:

Structural Gaps:

  • High-resolution structure: No atomic-resolution structure exists specifically for T. pseudonana atpG, limiting structure-based functional predictions.

  • Conformational dynamics: How atpG changes conformation during the catalytic cycle remains poorly understood, particularly in the context of diatom-specific adaptations.

  • Interaction interfaces: The precise molecular interactions between atpG and other ATP synthase components in diatoms lack detailed characterization.

Functional Gaps:

  • Regulatory mechanisms: How atpG function is regulated in response to changing environmental conditions (light intensity, nutrient availability, temperature) remains unclear.

  • Post-translational modifications: Potential modifications of atpG that might regulate its function have not been systematically investigated.

  • Isoform diversity: Whether alternative splicing or other mechanisms generate functional diversity in atpG expression is unknown.

Evolutionary Gaps:

  • Adaptive significance: The evolutionary pressures that have shaped atpG sequence and function in diatoms compared to other photosynthetic organisms remain speculative.

  • Horizontal gene transfer: The possibility of lateral gene transfer contributing to unique features of diatom ATP synthase has not been thoroughly investigated.

Methodological Gaps:

  • In vivo imaging: Techniques for visualizing atpG dynamics in living diatom cells are underdeveloped.

  • Heterologous expression systems: Optimized systems for producing functional diatom membrane proteins remain limited.

The genome-scale metabolic model (iThaps987) provides a systems-level framework for predicting atpG function , but experimental validation of these predictions represents a significant research opportunity.

How might knowledge of atpG contribute to biotechnological applications of Thalassiosira pseudonana?

Understanding atpG function has significant implications for harnessing T. pseudonana's biotechnological potential in several areas:

Bioenergy Applications:

High-Value Compound Production:

  • Nutraceutical synthesis: T. pseudonana produces fucoxanthin and other valuable compounds ; understanding energetic requirements via atpG research could help optimize production.

  • Metabolic engineering: The genome-scale model (iThaps987) suggests that T. pseudonana has potential for producing compounds like iso-butanol with minimal genetic modification .

Biosensor Development:

  • Environmental monitoring: Engineered systems based on atpG and ATP synthase function could serve as sensitive biosensors for environmental conditions.

  • Stress response indicators: Changes in atpG expression or modification could be developed into biomarkers for specific environmental stressors.

Model simulations using iThaps987 have already provided insights into T. pseudonana's preference for the violaxanthin-diadinoxanthin pathway over the violaxanthin-neoxanthin pathway for fucoxanthin production , demonstrating how systems-level understanding can guide biotechnological applications.

What emerging technologies could advance our understanding of atpG structure and function?

Several cutting-edge technologies offer promising avenues for deeper insights into atpG:

Structural Biology Advances:

  • Cryo-electron tomography: For visualizing ATP synthase in its native membrane environment with minimal perturbation.

  • Integrative structural biology: Combining multiple data sources (X-ray crystallography, NMR, SAXS, computational modeling) to build comprehensive structural models.

  • AlphaFold and similar AI approaches: For predicting structures based on sequence information when experimental structures are unavailable.

Functional Analysis Technologies:

  • Single-molecule techniques: Including optical tweezers and magnetic tweezers for measuring force generation and conformational changes in real-time.

  • Super-resolution microscopy: For visualizing ATP synthase distribution and dynamics in intact cells.

  • Nanoscale thermophoresis: For measuring binding affinities between atpG and interaction partners with minimal sample consumption.

Genetic Engineering Advances:

  • CRISPR-Cas9 in diatoms: For precise genome editing to create atpG variants or knockouts.

  • Optogenetic control: For temporal regulation of atpG expression or ATP synthase activity.

  • Cell-free expression systems: For rapid production and testing of atpG variants.

These technologies will enable researchers to bridge the gap between molecular details and systems-level understanding, advancing both fundamental knowledge of diatom biology and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.