Recombinant Thalassiosira pseudonana Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Thalassiosira pseudonana Cytochrome b6-f complex subunit 4 (petD) is a recombinant protein derived from the marine diatom Thalassiosira pseudonana . The petD subunit is a component of the cytochrome b6-f complex, which is essential for photosynthetic electron transport .

Basic Information

  • Product Type: Recombinant Protein

  • Source Organism: Thalassiosira pseudonana (Marine diatom) (Cyclotella nana)

  • UniProt Accession Number: A0T0T7

  • Gene Name: petD

  • Alternative Name: Cytochrome b6-f complex subunit 4

  • Sequence Length: 160 amino acids

Function and Significance

The cytochrome b6-f complex is integral to the photosynthetic process . It oxidizes plastoquinol (PQH2) and reduces plastocyanin, coupling this electron transfer to proton translocation across the thylakoid membrane . This process establishes an electrochemical gradient, which is then used by ATP synthase to produce ATP . Subunit 4 (petD) is essential for the assembly and stability of the cytochrome b6-f complex .

Protein Sequence and Structure

The amino acid sequence of Thalassiosira pseudonana Cytochrome b6-f complex subunit 4 (petD) is as follows :

MSIIKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYLFPVCILGTFACCIGLAVMAPTQMGEPADPFNTPLEILPEWYFFPTFNLLRVLPNKLLGVLAMAAVPAGLITVPFIENVNKFQNPFRRPIASLVFITGFIFAVWFGIGACLPIDKAVSLGYW

Role in Stress Response

Iron (Fe) limitation significantly impacts T. pseudonana's metabolism, affecting processes like post-translational modification, energy production, and protein biosynthesis . Under Fe-limiting conditions, the abundance of several proteins related to photosynthesis, including cytochrome f (a component of the cytochrome b6-f complex), decreases . This downregulation can impair the photosynthetic electron transport chain, potentially leading to increased production of reactive oxygen species (ROS) .

Experimental Analysis and Research Findings

Quantitative RT-PCR analysis has revealed that the expression of cytochrome f, a component of the cytochrome b6f complex, is reduced in T. pseudonana cells under iron-limited conditions . This reduction suggests that Fe limitation can disrupt the photosynthetic electron transport chain .

Potential Applications

Recombinant Thalassiosira pseudonana Cytochrome b6-f complex subunit 4 (petD) can be utilized in various research applications :

  • ELISA assays: As a recombinant protein, petD can serve as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) for detecting and quantifying petD-specific antibodies .

  • Structural studies: The recombinant protein can be used for X-ray crystallography or NMR spectroscopy to determine the three-dimensional structure of the petD subunit .

  • Functional studies: Recombinant petD allows for in vitro studies to understand its role in the assembly, stability, and function of the cytochrome b6-f complex .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Thalassiosira pseudonana (Marine diatom) (Cyclotella nana)
Target Names
petD
Target Protein Sequence
MSIIKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYLFPVCILGTFACCIGLAVMAPT QMGEPADPFNTPLEILPEWYFFPTFNLLRVLPNKLLGVLAMAAVPAGLITVPFIENVNKF QNPFRRPIASLVFITGFIFAVWFGIGACLPIDKAVSLGYW
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Thalassiosira pseudonana and why is its petD protein significant for research?

Thalassiosira pseudonana is a species of marine diatom that plays a crucial role in global primary production and the ocean's biogenic silicon cycle. Diatoms as a group are responsible for approximately 20% of global primary production and dominate the ocean's silicon cycle due to their silicified cell walls (frustules) . T. pseudonana has become an important model organism in diatom research, with its complete genome having been sequenced. The species was previously classified under Cyclotella nana and taxonomic studies continue to debate its proper classification .

The petD gene encodes subunit 4 of the Cytochrome b6-f complex, which serves as a critical component in photosynthetic electron transport. This protein is essential for energy conversion during photosynthesis, making it a significant target for research on photosynthetic mechanisms, particularly when studying how diatoms adapt to various environmental conditions. The petD protein contributes to both linear electron flow (which generates NADPH and ATP) and cyclic electron flow (which generates only ATP), making it a key player in photosynthetic energy balance .

How is recombinant T. pseudonana petD protein typically expressed and purified?

Recombinant T. pseudonana petD protein is typically expressed in heterologous systems such as Escherichia coli. The process generally follows these methodological steps:

  • Gene cloning: The petD gene sequence is optimized for the expression host, often with the addition of an N-terminal His-tag to facilitate purification.

  • Vector construction: The gene is inserted into an appropriate expression vector under the control of an inducible promoter.

  • Transformation: The vector is transformed into E. coli expression strains.

  • Culture growth: Transformed bacteria are grown to appropriate density before induction.

  • Protein expression: Expression is induced using appropriate agents (e.g., IPTG for lac-based promoters).

  • Cell harvesting and lysis: Cells are collected and lysed to release the recombinant protein.

  • Purification: His-tagged protein is purified using affinity chromatography, typically with Ni-NTA resin.

  • Quality assessment: Purity is assessed using SDS-PAGE, with greater than 90% purity typically achieved .

The purified protein is usually obtained as a lyophilized powder and requires reconstitution before use in experimental applications. For reconstitution, it is recommended to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. The addition of glycerol (typically 5-50% final concentration) is recommended for long-term storage to prevent protein degradation during freeze-thaw cycles .

What are the optimal storage conditions for recombinant T. pseudonana petD protein?

For optimal stability and activity, the recombinant petD protein should be stored following these guidelines:

  • Long-term storage: Store lyophilized powder at -20°C/-80°C upon receipt.

  • Working aliquots: Store at 4°C for up to one week.

  • Storage buffer: Tris/PBS-based buffer containing 6% Trehalose, pH 8.0 provides stability.

  • Aliquoting: Divide reconstituted protein into single-use aliquots to avoid repeated freeze-thaw cycles, which can lead to protein denaturation and loss of activity.

  • Glycerol addition: Adding glycerol to a final concentration of 5-50% (with 50% being commonly used) helps prevent damage during freezing.

  • Handling: Prior to opening, briefly centrifuge vials to bring contents to the bottom .

Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce protein stability and activity. When planning experiments, researchers should carefully consider the number of aliquots needed and their volumes to maximize protein usage efficiency.

How can recombinant petD be used to study photosynthetic electron transport in T. pseudonana?

Recombinant petD protein serves as a valuable tool for investigating the photosynthetic electron transport chain in T. pseudonana, particularly when employing these methodological approaches:

  • In vitro reconstitution studies: Purified recombinant petD can be used to reconstitute cytochrome b6-f complexes, allowing researchers to assess electron transport rates and efficiency. The process typically involves incorporating the protein into liposomes with other components of the electron transport chain and measuring electron transfer using spectroscopic methods.

  • Structure-function analysis: The recombinant protein enables researchers to examine how specific domains contribute to electron transport. This can be accomplished through site-directed mutagenesis of conserved residues followed by functional assays.

  • Protein-protein interaction studies: The His-tagged recombinant petD can be used in pull-down assays to identify interaction partners within the thylakoid membrane, providing insights into supramolecular complex formation.

  • Electron flow measurements: Researchers can utilize the recombinant protein in studies examining relative electron transfer rates (rETR) under various conditions. For example, research has shown that T. pseudonana can induce photosynthesis under anoxic conditions, with the cytochrome b6-f complex playing a crucial role in this process .

  • Cyclic electron flow (CEF) analysis: The petD protein is involved in CEF around Photosystem I, which becomes particularly important under stress conditions. Recombinant petD can be used to study this alternative electron pathway and its regulation in T. pseudonana .

When measuring photosynthetic activity relating to the cytochrome b6-f complex, researchers often use pulse amplitude modulated (PAM) fluorometry to assess parameters such as F₀ (minimum fluorescence), Fₘ (maximum fluorescence), and rETR (relative electron transfer rate) under various experimental conditions.

How can CRISPR/Cas9 technology be applied to study petD function in T. pseudonana?

CRISPR/Cas9 genome editing represents a powerful approach to investigate petD function in T. pseudonana through these methodological steps:

  • Vector construction: A CRISPR/Cas9 construct targeting the petD gene can be assembled using Golden Gate cloning, which has been successfully applied in T. pseudonana .

  • Guide RNA design: Sequence-specific guide RNAs targeting the petD locus must be carefully designed to ensure specificity and minimize off-target effects.

  • Donor template preparation: A double-stranded DNA donor matrix containing homology arms flanking a selectable marker (e.g., FCP:NAT resistance cassette) is constructed to enable homology-directed repair (HDR) .

  • Transformation: Both the CRISPR/Cas9 construct and donor template are introduced into T. pseudonana cells using appropriate transformation methods such as biolistic bombardment.

  • Selection and screening: Transformants are selected based on antibiotic resistance (e.g., nourseothricin for NAT marker). Successful homologous recombination can be verified using nested PCR, with efficiencies of up to 85% reported in T. pseudonana for other genes .

  • Phenotypic characterization: The impact of petD knockout or modification on photosynthetic efficiency can be assessed using chlorophyll fluorescence measurements, oxygen evolution, and growth assays under various light conditions.

  • Complementation studies: To confirm the specificity of observed phenotypes, complementation with wild-type or mutant petD variants can be performed.

Recent advancements in CRISPR/Cas-mediated homologous recombination have demonstrated high efficiency in T. pseudonana, making this diatom as genetically tractable as other model organisms like Nannochloropsis and Physcomitrella . This technology opens new possibilities for detailed functional studies of photosynthetic proteins, including the petD subunit of the cytochrome b6-f complex.

What role does petD play in cyclic electron flow under anoxic conditions in T. pseudonana?

The petD protein, as a component of the cytochrome b6-f complex, plays a crucial role in cyclic electron flow (CEF) around Photosystem I, particularly under anoxic conditions. Research findings indicate:

  • Anoxic photosynthetic induction: T. pseudonana can resume photosynthetic activity after dark anoxic incubation, with significant relative electron transfer rate (rETR) measured through Photosystem II after just 3 seconds of illumination .

  • Metabolic dependency: The resumption of photosynthetic activity under anoxic conditions appears to be dependent on catabolic pathways. Treatment with 3-bromopyruvic acid (3BP), which inhibits various catabolic enzymes, almost completely abolishes photosynthetic electron transport under anoxic conditions .

  • Electron acceptor reoxidation: The petD-containing cytochrome b6-f complex likely contributes to the reoxidation of electron acceptors in the absence of oxygen, enabling continued electron flow.

  • Calvin-Benson-Bassham cycle involvement: In T. pseudonana, the activity of the Calvin-Benson-Bassham (CBB) cycle appears to be important for maintaining electron transport under anoxic conditions. Addition of glycolaldehyde (GA), which inhibits the CBB cycle, prevents the increase in rETR during continuous illumination under anoxic conditions .

  • Alternative pathways: Research suggests that fermentative pathways, alongside CEF around PSI (which involves the cytochrome b6-f complex and petD), contribute to restoring photosynthetic activity under anoxic conditions in T. pseudonana .

This ability to maintain photosynthetic electron flow under anoxic conditions represents an important adaptation mechanism that may contribute to the ecological success of T. pseudonana in dynamic marine environments where oxygen levels can fluctuate.

How does petD sequence variation among Thalassiosira species impact functional studies?

Sequence variation in the petD gene among different Thalassiosira species presents both challenges and opportunities for functional studies:

  • Phylogenetic relationships: The petD gene, along with other chloroplast genes, has been used in phylogenetic analyses of Thalassiosira species. These analyses have revealed that T. pseudonana clusters with species of the genus Cyclotella, suggesting potential taxonomic reclassification .

  • Variation hotspots: While specific information about petD sequence variation is not directly provided in the search results, research on chloroplast genomes in Thalassiosira species has identified regions with high levels of variation. The presence of such variation hotspots suggests that functional differences might exist in photosynthetic complexes, including the cytochrome b6-f complex containing petD .

  • Experimental considerations: When designing experiments involving recombinant petD from T. pseudonana, researchers must be aware of possible sequence variations compared to other Thalassiosira species. These variations could affect protein-protein interactions, electron transport efficiency, and responses to environmental stressors.

  • Cross-species complementation: Sequence variations in petD could be leveraged to perform cross-species complementation experiments to identify functionally important residues conserved across the genus.

  • Structure-function correlations: Comparative analysis of petD sequences from different Thalassiosira species could help identify conserved domains essential for function versus regions that might contribute to species-specific adaptations.

The complexity of taxonomic relationships within the Thalassiosira genus, as evidenced by phylogenetic analyses based on chloroplast genes, underscores the importance of careful species identification and sequence verification when working with recombinant proteins from these organisms .

What are the common challenges in expressing functional recombinant T. pseudonana petD protein?

Expressing functional recombinant T. pseudonana petD protein presents several challenges that researchers should address through specific experimental approaches:

  • Membrane protein solubility: As a membrane protein component of the cytochrome b6-f complex, petD contains hydrophobic regions that can lead to aggregation during expression. This can be mitigated by:

    • Using specialized E. coli strains designed for membrane protein expression

    • Optimizing induction conditions (lower temperature, reduced inducer concentration)

    • Adding solubilizing agents or fusion partners to enhance solubility

  • Proper folding: Ensuring correct folding of the recombinant protein is critical for function. Strategies include:

    • Co-expression with chaperone proteins

    • Expression at lower temperatures (16-20°C) to slow folding kinetics

    • Addition of folding enhancers to the culture medium

  • Codon optimization: The codon usage in T. pseudonana differs from E. coli, potentially leading to translation issues. Research-grade codon-optimized synthetic genes can significantly improve expression levels.

  • Protein stability: The purified protein may exhibit limited stability. Researchers can improve stability by:

    • Including stabilizing agents such as trehalose (6%) in storage buffers

    • Adding glycerol at 5-50% final concentration for frozen storage

    • Determining optimal pH conditions (typically pH 8.0)

  • Post-translational modifications: If native post-translational modifications are required for function, eukaryotic expression systems might be necessary alternatives to E. coli.

Successful expression of functional recombinant petD protein requires careful optimization of multiple parameters and may necessitate iterative refinement of protocols based on protein yield, purity, and functional assays.

How can researchers validate the functional integrity of recombinant petD protein?

Validating the functional integrity of recombinant T. pseudonana petD protein requires multiple complementary approaches:

  • Spectroscopic characterization:

    • Absorption spectroscopy to verify characteristic spectral features of properly folded cytochrome b6-f components

    • Circular dichroism (CD) to assess secondary structure elements

    • Fluorescence spectroscopy to evaluate tertiary structure integrity

  • Electron transport assays:

    • Reconstitution with other components of the electron transport chain in liposomes

    • Measurement of electron transfer rates using artificial electron donors and acceptors

    • Cytochrome c reduction assays to assess electron transfer capability

  • Binding studies:

    • Interaction analysis with known binding partners using techniques such as surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC)

    • Co-immunoprecipitation with other components of the cytochrome b6-f complex

  • Structural integrity:

    • Limited proteolysis to verify proper folding (properly folded proteins typically show distinct, reproducible proteolytic patterns)

    • Size-exclusion chromatography to assess oligomeric state and aggregation

    • Thermal shift assays to evaluate protein stability

  • Functional complementation:

    • Introduction of recombinant protein into petD-deficient systems (when available) to assess functional rescue

    • In vitro reconstitution of electron transport activity

A combination of these approaches provides comprehensive validation of recombinant petD functionality, ensuring reliable results in subsequent research applications.

What are the best approaches for studying petD interactions with other components of the photosynthetic electron transport chain?

Investigating interactions between petD and other components of the photosynthetic electron transport chain requires sophisticated methodological approaches:

  • Co-immunoprecipitation (Co-IP):

    • Utilizing the His-tag on the recombinant petD protein for pull-down experiments

    • Identifying interaction partners through mass spectrometry analysis

    • Confirming specificity through appropriate controls (including tag-only controls)

  • Cross-linking coupled with mass spectrometry (XL-MS):

    • Application of chemical cross-linkers to stabilize transient interactions

    • Digestion of cross-linked complexes followed by tandem mass spectrometry

    • Computational analysis to identify interaction interfaces

  • Förster Resonance Energy Transfer (FRET):

    • Labeling of purified petD and potential interaction partners with appropriate fluorophores

    • Measurement of energy transfer as indication of proximity

    • Calculation of interaction distances based on FRET efficiency

  • Surface Plasmon Resonance (SPR):

    • Immobilization of His-tagged petD on sensor chips

    • Real-time monitoring of interactions with other purified components

    • Determination of binding kinetics and affinities

  • Reconstitution studies:

    • Incorporation of purified petD along with other components into liposomes

    • Measurement of functional electron transport as evidence of successful complex formation

    • Correlation of structural integrity with functional output

  • Structural analysis:

    • Cryo-electron microscopy of reconstituted complexes

    • X-ray crystallography of co-purified components (challenging but potentially highly informative)

    • Computational modeling of interactions based on known structures

These approaches can be particularly valuable when studying how petD interacts with components involved in cyclic electron flow around PSI, which becomes especially important under stressful conditions such as anoxia in T. pseudonana .

How does petD contribute to T. pseudonana's adaptation to variable environmental conditions?

The petD protein, as part of the cytochrome b6-f complex, plays a crucial role in T. pseudonana's adaptation to variable environmental conditions through several mechanisms:

  • Anoxic adaptation: Research has demonstrated that T. pseudonana can induce photosynthesis under anoxic conditions, with the cytochrome b6-f complex (including petD) being essential for maintaining electron flow. This adaptation allows the diatom to survive in environments with fluctuating oxygen levels .

  • Cyclic electron flow regulation: The petD-containing cytochrome b6-f complex participates in cyclic electron flow around Photosystem I, which generates ATP without producing NADPH. This alternative electron flow becomes particularly important under stress conditions when linear electron flow may be compromised .

  • Energy balance maintenance: By participating in both linear and cyclic electron flow pathways, petD helps T. pseudonana maintain optimal ATP:NADPH ratios under varying environmental conditions, supporting metabolic flexibility.

  • Integration with catabolic pathways: The resumption of photosynthetic activity under anoxic conditions appears to be linked to catabolic pathways, as evidenced by the inhibitory effect of 3-bromopyruvic acid. This suggests that petD function is integrated with broader metabolic networks that enable adaptation to environmental changes .

  • Calvin-Benson-Bassham cycle coordination: In T. pseudonana, the functionality of the Calvin-Benson-Bassham cycle appears to be coordinated with electron transport activities involving the cytochrome b6-f complex, as shown by the effects of glycolaldehyde inhibition .

These adaptations likely contribute to T. pseudonana's ecological success in marine environments, where light, nutrient, and oxygen levels can change rapidly. Understanding these mechanisms has implications for both fundamental diatom biology and biotechnological applications aimed at harnessing the metabolic potential of these organisms .

What are the implications of using CRISPR/Cas9 to modify petD in T. pseudonana for photosynthesis research?

The application of CRISPR/Cas9 technology to modify the petD gene in T. pseudonana opens significant new avenues for photosynthesis research:

  • Precise functional analysis: CRISPR/Cas9-mediated homologous recombination allows for precise gene targeting with high efficiency (up to 85% in T. pseudonana for other genes), enabling detailed structure-function analysis of petD through targeted mutations .

  • Reporter systems: The petD gene could be tagged with fluorescent proteins or other reporters to monitor its expression, localization, and turnover in response to environmental changes, providing insights into regulation.

  • Conditional knockouts: Development of inducible or conditional petD knockout systems using CRISPR/Cas9 would allow researchers to study the immediate effects of petD disruption on photosynthetic electron transport.

  • Domain swapping: CRISPR/Cas9 enables precise replacement of petD domains with counterparts from other species, helping identify structural elements responsible for specific functional adaptations.

  • Metabolic engineering: Modifications to petD could potentially be used to redirect electron flow in photosynthetic pathways, with implications for enhancing production of biofuels or high-value compounds in diatoms.

  • Study of compensatory mechanisms: Characterization of how T. pseudonana responds to petD modifications could reveal previously unknown regulatory mechanisms and compensatory pathways within the photosynthetic apparatus.

  • Evolutionary studies: Creating petD variants mirroring those found in different Thalassiosira species could provide insights into the evolution of photosynthetic adaptations across the genus.

The highly efficient gene targeting by homologous recombination makes T. pseudonana as genetically tractable as other model organisms, rapidly advancing functional diatom biology and opening new possibilities for biotechnological applications .

How can structural studies of recombinant petD inform the design of artificial photosynthetic systems?

Structural studies of recombinant T. pseudonana petD can provide valuable insights for designing artificial photosynthetic systems through these specific approaches:

  • Electron transfer pathway mapping: Detailed structural characterization of petD can reveal precise electron transfer pathways within the cytochrome b6-f complex, informing the design of synthetic electron transport components with optimized efficiency.

  • Cofactor coordination analysis: Understanding how petD contributes to cofactor coordination within the cytochrome b6-f complex can guide the development of synthetic proteins that properly position electron transfer cofactors.

  • Membrane integration principles: Structural studies of how petD integrates into thylakoid membranes can inform the design of artificial membrane proteins for synthetic photosynthetic systems.

  • Interface mapping: Characterization of interaction interfaces between petD and other components of the electron transport chain can guide the engineering of compatible interfaces in artificial systems.

  • Stability determinants: Identifying structural elements that contribute to the stability of petD under various conditions can inform the design of robust synthetic components capable of functioning across diverse environments.

  • Functional motifs: Structural studies may reveal conserved motifs responsible for specific functions, which could be incorporated as modular elements into artificial photosynthetic proteins.

  • Dynamic regulations: Analysis of conformational changes in petD during electron transport can provide insights into how to engineer dynamic properties into artificial systems for responsive regulation.

These structural insights could significantly advance the development of bio-inspired artificial photosynthetic systems for sustainable energy production, contributing to the broader goal of harnessing the metabolic potential of photosynthetic organisms for biotechnological applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.