Recombinant Thalassiosira pseudonana Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Cytochrome b6 (petB) is a core subunit of the cytochrome bf complex, which mediates electron transfer between Photosystem II and Photosystem I in photosynthetic organisms . In Thalassiosira pseudonana, petB is encoded in the chloroplast genome and plays a pivotal role in light-dependent reactions . Recombinant versions are produced to enable structural, functional, and biotechnological studies without requiring native diatom cultivation .

Production and Purification

ParameterSpecification
Expression HostEscherichia coli (standard for recombinant production)
TagDetermined during production (commonly His-tag for affinity purification)
Purity>90% (verified by SDS-PAGE)
StorageTris-based buffer with 50% glycerol; -20°C/-80°C for long-term stability

Notes:

  • Avoid repeated freeze-thaw cycles to prevent denaturation .

  • Working aliquots stored at 4°C retain activity for ≤1 week .

Role in Photosynthesis

  • Electron Transfer: Facilitates plastoquinol oxidation and proton gradient generation .

  • Stress Adaptation: PetB transcript stability is regulated by RNA-binding proteins (e.g., PrfB3) under light and stress conditions, ensuring cytochrome bf complex homeostasis .

Mutational Studies

  • CRISPR/Cas9-mediated knockout of petB in T. pseudonana disrupts the cytochrome bf complex, impairing photosynthetic efficiency .

  • In Arabidopsis, petB deficiency reduces cytochrome bf complex levels to <5% of wild-type, causing lethal photosynthetic defects .

Current Uses

  • Proteomics: Identified in chloroplast membranes during organelle isolation .

  • Biomineralization Studies: Insights into diatom biosilica formation linked to photosynthetic efficiency .

Emerging Frontiers

  • Biohybrid Systems: Integration into nanobiosensors for environmental monitoring .

  • Synthetic Biology: CRISPR-edited strains for enhanced photosynthetic output .

Challenges and Considerations

  • Stability Issues: Recombinant petB requires stringent storage conditions to maintain activity .

  • Species-Specific Variations: Sequence divergence between diatoms (e.g., T. pseudonana vs. Prochlorothrix hollandica) impacts functional studies .

Product Specs

Form
Lyophilized powder
Please note that we will preferentially ship the format currently in stock. However, if you have a specific requirement for the format, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Please note that the tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Thalassiosira pseudonana (Marine diatom) (Cyclotella nana)
Target Names
petB
Target Protein Sequence
MGKVYDWFEERLEVQAIADDISSKYVPPHVNIFYCFGGIVFTCFLVQVATGFAMTFYYRP SVVDAFASVEYIMTSVNFGWLIRSIHRWSASMMVMMLVLHVFRVYLTGGFKKPRELTWVT GVILAVVTVSFGVTGYSLPWDQVGFWACKIVTGVPAAVPIVGPPLVLVLRGGESVGQSTL TRFYSAHTFVLPLAAAVLMLTHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 (petB) is a component of the cytochrome b6-f complex. This complex plays a critical role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Thalassiosira pseudonana and why is it significant for molecular studies?

Thalassiosira pseudonana is a cosmopolitan centric diatom that holds the distinction of being the first eukaryotic marine phytoplankton to have its genome sequenced. This single-celled organism measures approximately 5-7 μm in length and 4-5 μm in width . Its significance stems from its evolutionary position and genetic characteristics. T. pseudonana shares only about half of its genome with the pennate diatom Phaeodactylum tricornutum, indicating substantial evolutionary diversity between these diatom lineages . This genomic divergence makes T. pseudonana an excellent model for studying diatom evolution and adaptation. Additionally, its complete genome sequence facilitates genetic manipulation studies, including recent advances in CRISPR/Cas-mediated genome editing that have made this organism highly genetically tractable .

How is the petB gene organized within diatom chloroplast genomes?

Based on comparative analysis of chloroplast genomes across Thalassiosira species, the petB gene is located within conserved gene blocks in the chloroplast DNA. Specifically, in Thalassiosira species, petB appears to be situated within a conserved block containing petA-trnW(cca), which spans approximately 19,300 bp and contains 16 genes . This organization is consistent with the arrangement seen in other photosynthetic organisms, where petB is typically part of a polycistronic operon. In spinach, for example, petB is found within the psbB operon alongside genes encoding the 51-kDa chlorophyll a apoprotein (psbB), the 10-kDa phosphoprotein (psbH), and subunit IV (petD) of the cytochrome b6/f complex .

What post-transcriptional processing mechanisms affect petB expression?

The expression of petB involves complex RNA maturation processes, particularly well-studied in spinach chloroplasts. The primary transcript undergoes multiple processing steps including:

  • Endonucleolytic cleavage at specific hexanucleotide motifs

  • 3'-exonucleolytic trimming at discrete RNA ends

  • Excision of class II intervening sequences (introns)

  • Formation of monocistronic and bicistronic mature mRNAs

In spinach, petB and petD form a bicistronic mRNA encoding both subunits of the cytochrome b6/f complex . This processing appears to be largely a stochastic process kinetically, resulting ultimately in the formation of translationally active RNA species. Importantly, the light conditions do not significantly affect this post-transcriptional modification, suggesting that regulation of cytochrome b6 expression may occur primarily at the translational level rather than through transcriptional or post-transcriptional mechanisms .

How do endosymbiotic gene transfer events affect chloroplast genes in Thalassiosira species?

Endosymbiotic gene transfer (EGT) has been observed in several Thalassiosira species, where certain chloroplast genes have been relocated to the nuclear genome. The most well-documented example is the petF gene, which encodes ferredoxin, a protein involved in iron uptake. This gene is absent from the chloroplast genome of T. oceanica and Thalassiosira sp. (CNS00561), having been transferred to the nuclear genome .

Similar putative petF genes (named PETF) have also been identified in the nuclear genomes of T. profunda, T. rotula, and T. nordenskioeldii, suggesting that such EGT events are common within this genus . While the search results do not specifically mention EGT of the petB gene in Thalassiosira species, the prevalence of gene transfer in this genus raises interesting questions about the evolutionary forces driving chloroplast genome reduction and the potential functional implications of nuclear versus chloroplast gene expression for photosynthetic proteins.

What approaches can be used for genetic modification of the petB gene in T. pseudonana?

Recent advances in CRISPR/Cas technology have significantly enhanced our ability to modify genes in T. pseudonana. A particularly effective approach involves:

  • Assembly of a CRISPR/Cas construct using Golden Gate cloning

  • Design of sequence-specific guide RNAs targeting the petB locus

  • Creation of a dsDNA donor matrix containing homologous arms flanking a resistance cassette

  • Transformation into T. pseudonana cells

  • Selection of transformants using the introduced resistance marker

  • Confirmation of successful editing using nested PCR and inverse PCR

This methodology has demonstrated remarkably high efficiency, with up to 85% of antibiotic-resistant colonies showing successful homologous recombination . The ability to perform efficient gene targeting by homologous recombination is particularly noteworthy given that T. pseudonana is a diploid organism, whereas such efficiency was previously reported primarily in haploid photosynthetic organisms . This makes T. pseudonana as genetically tractable as other model organisms like Nannochloropsis and Physcomitrella, opening numerous possibilities for functional studies of petB and other genes.

How can recombinant cytochrome b6 be effectively expressed and studied?

While the search results don't specifically address recombinant expression of T. pseudonana cytochrome b6, insights can be drawn from related work on membrane cytochromes. A successful approach for expressing membrane-integrated hemoproteins includes:

  • Computational design of surface features compatible with membrane insertion

  • Codon optimization for the expression host

  • Inclusion of appropriate purification and detection tags

  • Expression in specialized bacterial strains designed for membrane proteins, such as E. coli C43(DE3)

  • Membrane fraction isolation and purification

  • Confirmation of proper heme incorporation and membrane integration

The challenge with membrane proteins like cytochrome b6 is ensuring proper folding, cofactor incorporation, and membrane insertion. The computational design approach demonstrated for the de novo membrane cytochrome CytbX provides a valuable template that might be adapted for cytochrome b6 . This approach successfully produced a functional membrane cytochrome that spontaneously acquired heme molecules and could engage in electron transport reactions.

What methods are most effective for analyzing chloroplast gene expression patterns?

Analysis of chloroplast gene expression, including petB, requires a multi-faceted approach:

TechniqueApplicationAdvantagesLimitations
Northern blottingDetection of transcript size and abundanceVisualizes all RNA speciesLower sensitivity than qPCR
S1 nuclease protectionMapping transcript endsPrecise determination of 5' and 3' endsLabor intensive
RT-qPCRQuantification of transcript levelsHigh sensitivity and specificityMay miss complex processing patterns
RNA-SeqComprehensive transcriptome analysisUnbiased view of all transcriptsComputational complexity
Ribosome profilingTranslation efficiency analysisMeasures active translationRequires specialized equipment

For the complex RNA patterns observed in chloroplast operons like those containing petB, a combination of these techniques is typically necessary. In spinach chloroplasts, the RNA pattern of the psbB operon (containing petB) resolves into eighteen major RNA species, highlighting the complexity of chloroplast gene expression . These techniques can help distinguish between primary transcripts, processing intermediates, and mature mRNAs.

How can variation in petB sequences be assessed across Thalassiosira species?

Comparative analysis of petB sequences across Thalassiosira species can reveal important evolutionary patterns and functional constraints. The methodology employed for such analysis typically includes:

  • PCR amplification or extraction of complete chloroplast genomes

  • Sequencing using next-generation sequencing platforms

  • Genome assembly and annotation

  • Identification of conserved gene blocks containing petB

  • Multiple sequence alignment of petB coding sequences

  • Sliding window analysis to identify variation hotspots

  • Phylogenetic analysis to infer evolutionary relationships

This approach has been successfully applied to analyze variation in chloroplast genes across multiple Thalassiosira species, identifying regions with high levels of sequence diversity . While petB itself was not specifically highlighted as a variation hotspot in the provided search results, the methodology used to identify the Thalassiosira chloroplast 1 (thcp1) region could be applied to analyze petB sequence conservation and variability.

How can the functionality of recombinant cytochrome b6 be assessed?

Assessing the functionality of recombinant cytochrome b6 requires multiple approaches to verify proper folding, cofactor incorporation, membrane integration, and biological activity:

  • Spectroscopic analysis: UV-visible absorption spectroscopy can confirm proper heme incorporation by examining characteristic absorption peaks.

  • Redox potential measurements: Cyclic voltammetry or potentiometric titrations can determine if the recombinant protein exhibits the expected redox properties.

  • Electron transfer assays: Reconstitution of electron transport pathways with known partners can assess biological activity.

  • Structural analysis: Circular dichroism spectroscopy can evaluate secondary structure elements, while more advanced techniques like cryo-electron microscopy might reveal detailed structural features.

  • Membrane integration: Biochemical fractionation followed by immunoblotting can confirm proper localization to the thylakoid membrane.

The functionality of de novo membrane cytochromes has been successfully assessed using some of these approaches, demonstrating that designed metalloproteins can engage in electron transport reactions with other proteins and small molecules . Similar methodologies could be applied to recombinant T. pseudonana cytochrome b6.

What are the technical challenges in working with recombinant diatom proteins?

Working with recombinant proteins from diatoms presents several technical challenges:

  • Codon optimization: Diatom codon usage differs from common expression hosts, necessitating optimization for efficient expression.

  • Post-translational modifications: Diatoms may have unique post-translational modifications that affect protein function and are difficult to replicate in heterologous systems.

  • Membrane integration: For membrane proteins like cytochrome b6, achieving proper folding and membrane insertion in heterologous systems is particularly challenging.

  • Cofactor incorporation: Ensuring proper incorporation of prosthetic groups such as heme is essential for functionality.

  • Protein-protein interactions: Cytochrome b6 functions as part of a multi-subunit complex, and isolated expression may affect stability and function.

  • Scale-up considerations: Obtaining sufficient quantities of properly folded protein for structural and functional studies often requires optimization of expression and purification protocols.

These challenges necessitate careful experimental design and often require testing multiple expression systems and conditions to achieve successful recombinant expression of functional diatom proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.