Recombinant Thalassiosira pseudonana Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify this in your order; we will prioritize its implementation.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Thalassiosira pseudonana (Marine diatom) (Cyclotella nana)
Target Names
ycf4
Target Protein Sequence
MQDQIRQEKIVGSRRFSNYFWASLLLVGGLMFLLAGISSYLKINLLPFANTTELVFIPQG IVMMFYGTLSFGLSIYIMATLFWDIGSGYNEYNKVENLVKVVRRGFPGKNREILLTYPLN NIRSIGIKISEGLNPQRIIYLCLKDERKIPLTPVQQPDSISDLEDQAADLAKFLDLKLEN L
Uniprot No.

Target Background

Function

Appears essential for the assembly of the photosystem I complex.

Database Links
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Ycf4 and what is its fundamental role in photosynthesis?

Ycf4 is a thylakoid membrane protein encoded by the plastid genome that functions as an assembly factor for photosystem I (PSI). It is part of a large complex (>1500 kD) that acts as a scaffold for the assembly of newly synthesized PSI polypeptides . The protein plays a pivotal role in initial assembly steps of PSI by directly mediating interactions between newly synthesized PSI polypeptides and assisting in the assembly of the PSI complex .

While earlier studies in cyanobacteria suggested Ycf4 (orf184) was not essential for photosynthesis, with mutants still able to assemble PSI at reduced levels , more recent complete knockout studies in tobacco revealed that plants lacking the full Ycf4 sequence were unable to survive photoautotrophically, demonstrating that Ycf4 is essential for photosynthesis . This contradicts previous reports based on partial knockouts that suggested it was non-essential.

Recent research indicates that Ycf4 functions extend beyond PSI assembly to regulating plastid gene expression, as evidenced by transcriptome analysis showing decreased expression of genes encoding Rubisco large subunit (rbcL), Light-Harvesting Complex (LHC), and ATP Synthase (atpB and atpL) in Ycf4 knockout plants .

How does the structure of Ycf4 relate to its function in T. pseudonana and other photosynthetic organisms?

The structural analysis of Ycf4 reveals important insights about its functional domains. In silico protein-protein interaction studies have demonstrated that the C-terminus (91 amino acids of the 184 total) of Ycf4 is particularly important for interactions with other chloroplast proteins . This was confirmed by comparing the interaction patterns of full-length Ycf4 with truncated versions containing either the N-terminal 93 amino acids or the C-terminal 91 amino acids.

The C-terminal domain showed stronger interactions with multiple proteins including the RNA polymerase subunit rpoB (25 hydrogen bonds with the C-terminus versus 9 with the N-terminus) and core subunits of the Light-Harvesting Complex of PSI (LHCA1, LHCA2, LHCA3, LHCA4) as well as the nuclear-encoded small subunit of Rubisco (RBCS) .

This structural importance explains why previous studies using incomplete knockouts (removing only 93 of 184 amino acids from the N-terminus) concluded that Ycf4 was non-essential, while complete deletion studies revealed its crucial role in photosynthesis .

What experimental evidence supports the role of Ycf4 in PSI complex assembly?

Several lines of experimental evidence support Ycf4's role in PSI assembly:

  • Protein complex purification studies: In Chlamydomonas reinhardtii, tandem affinity purification (TAP) of Ycf4 isolated a stable complex containing PSI subunits PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF, as identified by mass spectrometry and immunoblotting . This complex also contained the opsin-related protein COP2.

  • Pulse-chase protein labeling: This technique revealed that the PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex, indicating the complex's role in early assembly stages .

  • Electron microscopy: Visualization of purified Ycf4 complexes showed large structures measuring 285 × 185 Å, potentially representing oligomeric states involved in scaffolding PSI assembly .

  • Knockout phenotypes: Complete knockout of Ycf4 in tobacco resulted in plants unable to grow photoautotrophically, with structural anomalies in chloroplasts including altered shape, size, and grana stacking compared to wild-type plants .

How does Ycf4 function differ between diatoms, green algae, and higher plants?

The function of Ycf4 shows both conservation and variation across photosynthetic organisms:

What molecular techniques can be used to study Ycf4 function in T. pseudonana?

Several advanced molecular techniques have been developed specifically for studying genes like Ycf4 in T. pseudonana:

  • CRISPR/Cas9-mediated homologous recombination: This technique enables efficient gene targeting in T. pseudonana with up to 85% efficiency for NAT-resistant colonies . The method involves:

    • Assembly of CRISPR/Cas constructs using Golden Gate cloning

    • Pairing sequence-specific CRISPR/Cas with a dsDNA donor matrix

    • Substitution of target genes with a resistance cassette (FCP:NAT)

    • Confirmation of precise integration using nested PCR and inverse PCR approaches

  • Endogenous GFP tagging: A single vector CRISPR/Cas9 guided GFP knock-in strategy has been developed for T. pseudonana that enables:

    • Tagging proteins at their native genomic locus without co-integration of antibiotic markers

    • Expression of tagged proteins at native levels under their endogenous promoters

    • Visualization of protein localization under physiologically relevant conditions

  • Golden Gate-based modular cloning (MoClo) framework: This system enables:

    • Rapid and scalable cloning for diverse applications

    • Episomal delivery via bacterial conjugation without specialized transformation equipment

    • Testing various promoter-terminator pairs and fluorophores

    • Combining CRISPR/Cas9 gene editing with fluorescent protein tagging

How can CRISPR/Cas9 be optimized for studying Ycf4 in T. pseudonana?

Optimizing CRISPR/Cas9 for Ycf4 studies in T. pseudonana requires careful consideration of several factors:

  • Construct design: For efficient genome editing, CRISPR/Cas constructs should be assembled using Golden Gate cloning, which enables highly efficient homologous recombination in this diploid photosynthetic organism . The system includes:

    • Sequence-specific CRISPR/Cas component targeting Ycf4 locus

    • A dsDNA donor matrix containing homology arms flanking the target region

    • Resistance cassette (FCP:NAT) for selection of transformants

  • Delivery method: A single vector system combining all components has proven effective:

    • Episomal vectors containing CEN6-ARSH4-HIS3 elements that prevent random integration

    • Origin of Transfer (oriT) required for vector transfer during bacterial conjugation

    • Nourseothricin N-acetyl transferase (NAT) gene for antibiotic selection

  • Verification strategies:

    • Nested PCR to screen for homologous recombination events (up to 85% efficiency reported)

    • Inverse PCR approach to confirm precise integration at the target locus

    • For GFP tagging, microscopy to verify protein localization

What experimental approaches can be used to study Ycf4 protein-protein interactions in diatoms?

Several approaches can be employed to study Ycf4 protein-protein interactions in diatoms:

  • Tandem affinity purification (TAP): This technique has been successfully used in Chlamydomonas to isolate Ycf4 complexes and could be adapted for T. pseudonana:

    • Fusion of a TAP tag (containing calmodulin binding peptide and Protein A domains) to Ycf4

    • Two-step affinity purification using IgG agarose and calmodulin resin

    • Identification of interacting partners by mass spectrometry (LC-MS/MS)

  • In vivo fluorescence approaches with endogenous GFP tagging:

    • CRISPR/Cas9-mediated knock-in of GFP at the native Ycf4 locus

    • Fluorescence microscopy to visualize protein localization

    • Potential for fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) studies if paired with other tagged proteins

  • Protein crosslinking coupled with mass spectrometry:

    • Chemical crosslinking of protein complexes in vivo

    • Purification of crosslinked complexes

    • Identification of interaction partners by mass spectrometry

  • In silico protein-protein interaction prediction:

    • Computational modeling of protein-protein interactions as demonstrated for tobacco Ycf4

    • Analysis of hydrogen bonding patterns between Ycf4 domains and potential interacting partners

    • Validation of predicted interactions through experimental approaches

How can researchers investigate the specific role of the C-terminal domain of Ycf4?

Based on the finding that the C-terminal domain of Ycf4 is critical for protein interactions , several approaches can be used to investigate its specific role:

  • Domain-specific mutagenesis:

    • CRISPR/Cas9-mediated homologous recombination to create precise mutations or deletions in the C-terminal domain

    • Comparison of phenotypes between wild-type, complete knockout, and C-terminal domain mutants

    • Analysis of PSI assembly and other photosynthetic parameters

  • Structure-function analysis:

    • Expression of truncated or mutated versions of Ycf4 in knockout backgrounds

    • Systematic mutation of key residues predicted to be involved in protein-protein interactions

    • Assessment of which specific regions or amino acids are essential for function

  • Protein-protein interaction mapping:

    • TAP-tagging of wild-type and C-terminally truncated Ycf4

    • Comparative analysis of protein complexes pulled down with each variant

    • Identification of interactions specifically mediated by the C-terminal domain

  • Heterologous expression systems:

    • Expression of T. pseudonana Ycf4 in other organisms (e.g., E. coli, yeast)

    • In vitro binding assays with purified interaction partners

    • Structural studies (X-ray crystallography, cryo-EM) of the C-terminal domain alone or in complex with partners

What methods can be used to study the transcriptional regulatory function of Ycf4?

The unexpected finding that Ycf4 may regulate plastid gene expression suggests several approaches to investigate this function:

  • Transcriptome analysis:

    • RNA-seq comparison between wild-type and Ycf4 mutant plants

    • Differential expression analysis to identify genes regulated by Ycf4

    • Time-course experiments to determine immediate versus secondary effects of Ycf4 loss

  • Chromatin immunoprecipitation (ChIP):

    • GFP-tagged Ycf4 for ChIP-seq analysis

    • Identification of potential DNA binding sites or association with transcriptional machinery

    • Validation of binding through electrophoretic mobility shift assays (EMSA)

  • Protein-protein interaction with transcription factors:

    • Immunoprecipitation followed by mass spectrometry to identify interactions with RNA polymerase or other transcription factors

    • Yeast two-hybrid or split-GFP assays to validate specific interactions

    • In silico modeling to predict interaction surfaces

  • Reporter gene assays:

    • Construction of reporter systems to measure transcriptional activity

    • Testing the effect of wild-type versus mutant Ycf4 on reporter expression

    • Identification of minimal regions necessary for transcriptional regulation

How can researchers resolve contradictory findings about Ycf4 essentiality across different studies?

The literature contains contradictory findings about Ycf4 essentiality , which can be resolved through:

  • Complete versus partial knockout comparison:

    • Generation of both complete and partial (N-terminal, C-terminal) knockouts in the same organism

    • Detailed phenotypic characterization under identical conditions

    • Assessment of PSI assembly, growth, and transcriptional effects in each case

  • Cross-species complementation studies:

    • Expression of Ycf4 from different species (cyanobacteria, green algae, diatoms, higher plants) in Ycf4 knockout backgrounds

    • Determination of which orthologs can rescue which phenotypes

    • Identification of conserved versus species-specific functions

  • Controlled environmental studies:

    • Testing knockout phenotypes under various light intensities, nutrient conditions, and stress factors

    • Determining if essentiality is condition-dependent

    • Monitoring long-term adaptation to Ycf4 loss

What are the implications of Ycf4 research for understanding photosynthesis evolution?

The varying degrees of Ycf4 essentiality across photosynthetic organisms provides insight into the evolution of photosynthetic machinery. In cyanobacteria, Ycf4 appears less critical, while in eukaryotic phototrophs (green algae, higher plants), it becomes essential . This suggests that as photosynthetic machinery evolved greater complexity, particularly with the compartmentalization in chloroplasts, the role of assembly factors like Ycf4 became more crucial.

The finding that Ycf4 may have additional functions in regulating plastid gene expression in higher plants indicates functional evolution of this protein beyond its ancestral role . Further comparative studies across diverse photosynthetic lineages, including diatoms like T. pseudonana, will help elucidate how assembly factors have adapted to different cellular contexts and evolutionary pressures.

How might Ycf4 research contribute to improving photosynthetic efficiency?

Understanding the molecular mechanisms of PSI assembly mediated by Ycf4 could provide targets for enhancing photosynthetic efficiency. Research has shown that manipulation of PSI assembly factors might alter the stoichiometry of photosystems or their composition, potentially optimizing light capture and energy conversion under specific conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.