Recombinant Thalassiosira pseudonana Photosystem I reaction center subunit XI (psaL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
psaL; Photosystem I reaction center subunit XI; PSI subunit V; PSI-L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Thalassiosira pseudonana (Marine diatom) (Cyclotella nana)
Target Names
psaL
Target Protein Sequence
MANFIKPYNDDPFVGHLATPITSSSLTRALLKNLPAYRFGLTPLLRGLEIGLAHGYFLIG PFAQLGPLRNSDIGLLAGFLSTIGLILILTLGLTIYGAAAFGQEKSNGSELQTKKSWDQF KGGFFVGACGSAGFAFICLSSIPTFALN
Uniprot No.

Target Background

Database Links
Protein Families
PsaL family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of psaL in Thalassiosira pseudonana?

The psaL subunit in T. pseudonana's Photosystem I (PSI) plays a crucial role in the structural organization of the PSI complex. Based on comparative analysis with other photosynthetic organisms, psaL functions in stabilizing PSI complexes and potentially mediating interactions between PSI monomers or oligomers. In T. pseudonana, PSI exists in different forms with varying numbers of associated fucoxanthin chlorophyll a/c-binding proteins (FCPIs), with cryo-EM structures showing PSI-FCPI supercomplexes containing either 13 or 5 FCPIs under high light conditions . The psaL subunit likely contributes to maintaining the structural integrity of these supercomplexes and may be involved in facilitating appropriate interactions with the FCPI antenna proteins that remain stably associated with PSI under varying light conditions.

How does the structure of T. pseudonana PSI complex differ from other photosynthetic organisms?

T. pseudonana PSI exhibits several distinctive structural features compared to other photosynthetic organisms:

  • Antenna system: T. pseudonana utilizes fucoxanthin chlorophyll a/c-binding proteins (FCPIs) rather than the Lhca proteins found in plants or phycobilisomes in cyanobacteria .

  • Supercomplex composition: Under high light conditions, T. pseudonana forms PSI-FCPI supercomplexes with either 13 or 5 FCPIs . The specific FCPIs that remain stably associated with the PSI core include Lhcr3, RedCAP, Lhcq8, Lhcf10, and FCP3 .

  • FCPI distribution: The specific arrangement of FCPIs around the PSI core creates a unique pigment network with potentially higher efficiency of excitation energy transfer .

  • Specific antenna associations: Particular Lhc proteins are specifically associated with PSI, including Lhcr 1, 3, 4, 7, 10-14, and Lhcf10 .

These structural differences reflect evolutionary adaptations to the marine environment where diatoms thrive and contribute to their remarkable success in fluctuating oceanic conditions.

How is the psaL gene organized in the T. pseudonana genome?

The psaL gene in T. pseudonana is part of its nuclear genome, which consists of approximately 34 mega base pairs . T. pseudonana was the first eukaryotic marine phytoplankton chosen for whole genome sequencing, with the sequenced clone CCMP 1335 available from the National Center for Marine Algae and Microbiota at Bigelow Laboratory for Ocean Sciences .

The genomic organization of photosynthetic genes in diatoms reflects their complex evolutionary history involving secondary endosymbiosis. While specific details about the psaL gene organization aren't explicitly provided in the available search results, researchers investigating this gene should consider:

  • Potential regulatory elements in promoter regions that respond to light and nutrient availability

  • Possible intron-exon structure affecting expression and regulation

  • Conservation patterns when compared to psaL genes in other diatom species

What are the best methods for isolating and purifying native PSI complexes containing psaL from T. pseudonana?

Based on successful approaches described in the literature, the following methodology is recommended for isolating intact PSI-FCPI complexes containing psaL from T. pseudonana:

  • Cell cultivation and harvesting:

    • Grow T. pseudonana under controlled light conditions (specific to experimental question)

    • Harvest cells during exponential growth phase

    • Wash cells in appropriate buffer to remove media components

  • Thylakoid membrane isolation:

    • Disrupt cells using methods that preserve protein complexes (e.g., French press, glass beads)

    • Separate thylakoid membranes using differential centrifugation

    • Wash membranes to remove soluble proteins

  • Membrane solubilization:

    • Use mild detergents (e.g., n-dodecyl-β-D-maltoside, digitonin) at optimized concentrations

    • Maintain low temperature (4°C) during solubilization

    • Remove insoluble material by centrifugation

  • PSI complex purification:

    • Employ sucrose density gradient centrifugation to separate protein complexes

    • Collect fractions corresponding to PSI-FCPI supercomplexes

    • Alternative/complementary approach: Use native PAGE for separation

  • Complex characterization:

    • Analyze protein composition using SDS-PAGE and mass spectrometry

    • Verify PSI activity using spectroscopic methods

    • Confirm psaL presence using specific antibodies or mass spectrometry

This approach has been successfully used to isolate different PSI-FCPI populations from T. pseudonana, including complexes with varying numbers of associated FCPI proteins .

How can I express recombinant T. pseudonana psaL in heterologous systems?

Expressing recombinant T. pseudonana psaL requires careful consideration of expression systems and conditions due to its nature as a membrane protein component of a photosynthetic complex. The following methodological approach is recommended:

  • Expression system selection:

    • E. coli-based expression: Consider using the SEGA (Standardized Genome Architecture) platform, which facilitates genome engineering with high efficiency (80-100% success rate) through λ-Red recombineering

    • Alternative eukaryotic systems: For proper post-translational modifications, consider yeast (Pichia pastoris) or insect cell expression systems

  • Gene optimization:

    • Codon-optimize the psaL sequence for the chosen expression host

    • Consider adding purification tags (His, Strep, FLAG) at N- or C-terminus

    • Include TEV or similar protease sites for tag removal if needed

  • Expression optimization matrix:

ParameterVariables to testNotes
Temperature16°C, 25°C, 30°CLower temperatures often favor membrane protein folding
Inducer concentration0.1-1.0 mM IPTG or equivalentTitrate to find optimal expression level
Media compositionLB, TB, minimal mediaRich media may provide better yields
Induction timingEarly, mid, late log phaseOptimal timing depends on protein toxicity
AdditivesGlycerol, sorbitol, specific lipidsCan improve membrane protein folding
  • Membrane targeting strategies:

    • Include appropriate signal sequences for membrane insertion

    • Consider fusion partners that aid membrane localization

    • For E. coli, the green-white colony screening method can help identify successful recombinants

  • Solubilization and purification:

    • Test multiple detergents for optimal extraction (DDM, LMNG, digitonin)

    • Implement step-wise purification using affinity chromatography followed by size exclusion

    • Consider reconstitution into nanodiscs or liposomes for functional studies

This comprehensive approach addresses the challenges of membrane protein expression while leveraging advanced techniques like SEGA that simplify genome engineering for recombinant protein production.

What spectroscopic methods are most informative for characterizing recombinant psaL?

Multiple complementary spectroscopic techniques provide valuable information about recombinant psaL structure, conformation, and functional properties:

Integration of multiple spectroscopic approaches provides comprehensive characterization of recombinant psaL structure and function.

How do mutations in the psaL gene affect PSI assembly and function in T. pseudonana?

To systematically investigate the effects of psaL mutations on PSI assembly and function in T. pseudonana, researchers should implement the following methodological framework:

  • Targeted mutagenesis strategy:

    • Employ CRISPR-Cas9 gene editing to introduce specific mutations in the endogenous psaL gene

    • Focus on conserved residues identified through sequence alignment with psaL from other species

    • Target residues at interfaces with other PSI subunits or FCPI proteins based on structural data

    • Create a comprehensive mutation library spanning different functional domains

  • Mutant characterization workflow:

    a. Growth and physiological assessment:

    • Compare growth rates under varying light intensities (low, medium, high)

    • Measure photosynthetic efficiency using oxygen evolution or PAM fluorometry

    • Quantify pigment composition changes using HPLC analysis

    b. Biochemical characterization:

    • Isolate thylakoid membranes and analyze protein complex composition

    • Use blue native PAGE to assess PSI-FCPI supercomplex assembly

    • Quantify PSI:PSII ratios and changes in antenna association

    c. Structural analysis:

    • Purify PSI complexes from selected mutants for structural studies

    • Implement cryo-EM analysis to determine structural alterations

    • Compare with wild-type structures to identify specific structural changes

    d. Functional analysis:

    • Measure P700 oxidation kinetics to assess electron transport efficiency

    • Determine energy transfer rates from antenna to reaction center

    • Evaluate photoinhibition susceptibility and recovery kinetics

  • Data integration for structure-function relationships:

    • Correlate specific mutations with observed phenotypic, structural, and functional changes

    • Develop models explaining the role of specific psaL domains in PSI assembly and function

    • Identify critical residues essential for PSI-FCPI interactions under varying light conditions

This systematic approach would provide comprehensive insights into how psaL contributes to the unique structural and functional properties of PSI in T. pseudonana, potentially revealing diatom-specific adaptations to marine environments.

What is the role of psaL in PSI-FCPI supercomplex formation under varying light conditions?

The search results suggest that T. pseudonana PSI-FCPI supercomplexes undergo dynamic remodeling in response to changing light conditions, with 8 Lhcr FCPIs detaching from the PSI-13FCPI supercomplex under high light, leaving 5 FCPIs stably combined with the PSI core . To investigate psaL's specific role in this process, the following research methodology is recommended:

  • Light acclimation experimental design:

    • Cultivate T. pseudonana under controlled light regimes:

      • Low light (LL): 30-50 μmol photons m⁻² s⁻¹

      • Medium light (ML): 100-200 μmol photons m⁻² s⁻¹

      • High light (HL): 500-1000 μmol photons m⁻² s⁻¹

    • Include light shift experiments to capture dynamic responses

    • Combine with nitrogen availability variations to assess interactive effects

  • Supercomplex isolation and characterization:

    • Isolate intact PSI-FCPI supercomplexes using native methods

    • Quantify the distribution of different PSI-FCPI forms (e.g., PSI-13FCPI vs. PSI-5FCPI)

    • Analyze the specific FCPI composition under each condition

    • Compare with data from other diatom species (e.g., T. punctigera)

  • psaL contribution analysis:

    • Create psaL variants with mutations at potential FCPI interaction sites

    • Develop psaL-specific antibodies for immunoprecipitation studies

    • Use crosslinking approaches to map direct contacts between psaL and FCPIs

    • Implement comparative transcriptomic analysis to assess coordinated expression

  • Functional implications assessment:

    • Measure energy transfer efficiency within different supercomplex forms

    • Determine electron transport rates under varying light conditions

    • Assess photoprotection capacity and recovery from high light exposure

    • Correlate supercomplex composition with photosynthetic performance

This integrated approach would reveal how psaL contributes to the dynamic remodeling of PSI-FCPI supercomplexes in response to changing light environments, providing insights into the molecular mechanisms underlying diatoms' remarkable ecological success in fluctuating marine environments.

How can cryo-electron microscopy be optimized for high-resolution analysis of PSI-psaL interactions?

Based on the successful cryo-EM studies of T. pseudonana PSI-FCPI at 2.3-2.8 Å resolution , the following optimized methodology is recommended for high-resolution analysis specifically focusing on psaL interactions:

  • Sample preparation optimization:

    • Isolate intact PSI-FCPI supercomplexes using gentle solubilization (digitonin preferred)

    • Implement GraFix (gradient fixation) to stabilize complexes if necessary

    • Test multiple buffer compositions to identify optimal conditions:

      • HEPES vs. Tris vs. phosphate buffer systems

      • pH range 6.5-8.0

      • Varying salt concentrations (50-200 mM)

    • Apply sample to graphene oxide or thin carbon support films to improve particle orientation distribution

  • Grid preparation protocol:

    • Use Quantifoil R1.2/1.3 or similar holey carbon grids

    • Implement controlled blotting parameters (4°C, 95% humidity)

    • Test both standard and back-side blotting approaches

    • Vitrify using liquid ethane at optimal temperature

  • Data collection strategy:

ParameterRecommended SettingRationale
Microscope300 kV with energy filterHigher contrast and resolution
DetectorK3/Falcon 4 in counting modeImproved DQE and motion correction
Defocus range-0.8 to -2.5 μmBalance contrast and high-resolution information
Total dose40-60 e⁻/ŲBalance radiation damage with signal
Frame count40-50 framesEnhanced motion correction
Pixel size0.5-0.8 Å/pixelAppropriate for 2-3 Å resolution
  • Image processing workflow:

    • Implement motion correction with dose weighting

    • Perform CTF estimation with astigmatism correction

    • Use reference-free 2D classification to select intact particles

    • Employ 3D classification to separate different conformational states

    • Apply focused refinement on the psaL region using appropriate masks

    • Implement Bayesian polishing and CTF refinement for resolution optimization

  • Model building and validation:

    • Use existing structures as initial templates where available

    • Build de novo in regions with sufficient resolution

    • Implement real-space refinement with appropriate restraints

    • Validate using independent half-maps and geometric criteria

    • Pay particular attention to psaL interfaces with other subunits and FCPIs

This optimized approach builds on the successful methodologies that have already yielded high-resolution structures of T. pseudonana PSI-FCPI , with specific enhancements to focus on psaL interactions and potentially achieve even higher resolution in regions of interest.

What are the differences in psaL-mediated PSI organization between diatoms and other photosynthetic organisms?

The search results indicate that diatoms like T. pseudonana have evolved unique PSI organizations adapted to their marine environment. To systematically investigate the specific role of psaL in these differences, the following comparative analysis approach is recommended:

  • Comparative structural analysis:

    • Compare cryo-EM structures of PSI-FCPI from T. pseudonana with structures from:

      • Cyanobacteria (typically form trimers)

      • Green algae (typically form monomers)

      • Higher plants (typically form monomers)

      • Other diatom species (e.g., Chaetoceros gracilis)

    • Focus analysis on psaL structure, positioning, and interaction surfaces

    • Identify unique structural features in diatom psaL that influence complex organization

  • Sequence-structure relationship mapping:

    • Perform multiple sequence alignments of psaL from diverse photosynthetic lineages

    • Quantify conservation patterns and identify clade-specific residues

    • Map conservation onto structural models to identify functionally important regions

    • Identify potential coevolution patterns with interacting proteins

  • Experimental validation approaches:

    • Implement blue native PAGE to compare PSI oligomeric states across species

    • Use analytical ultracentrifugation to precisely determine oligomeric distributions

    • Create chimeric psaL proteins combining domains from different species

    • Test functional complementation across species barriers

  • Functional significance assessment:

    • Compare photosynthetic efficiency parameters across species

    • Measure light harvesting efficiency under conditions mimicking natural habitats

    • Evaluate photoprotection mechanisms related to PSI organization

    • Assess evolutionary advantages of specific PSI arrangements in different environments

Organism GroupTypical PSI OrganizationKey Features of psaLEnvironmental Adaptation
CyanobacteriaTrimersMediates trimerizationHigh light tolerance
Green algaePrimarily monomersModified trimerization interfaceVaried aquatic environments
Higher plantsMonomersLost trimerization capacityTerrestrial environments
Diatoms (T. pseudonana)Monomers with unique FCPI associationsSpecialized for FCPI interactionFluctuating marine environments

This comparative approach would reveal how evolutionary modifications to psaL have contributed to the distinct PSI organizations observed across photosynthetic lineages, providing insights into the molecular basis of diatoms' remarkable ecological success.

What are the main challenges in obtaining functionally active recombinant psaL?

Obtaining functionally active recombinant psaL from T. pseudonana presents several technical challenges that must be addressed with appropriate methodological solutions:

  • Membrane protein expression barriers:

    • Challenge: Hydrophobic transmembrane domains often cause aggregation or inclusion body formation

    • Solution: Test multiple expression systems (E. coli, yeast, insect cells) and optimize expression conditions (temperature, induction timing, media composition)

    • Implementation: Consider using the SEGA platform for E. coli expression, which offers high efficiency for recombinant protein integration

  • Protein folding and stability issues:

    • Challenge: Maintaining proper folding of membrane proteins outside their native environment

    • Solution: Include stabilizing additives (glycerol, specific lipids) and optimize solubilization conditions

    • Evidence: Similar approaches have been effective with other T. pseudonana proteins, which exhibit complex folding properties including both structured and intrinsically disordered regions

  • Appropriate membrane mimetic selection:

    • Challenge: Finding suitable membrane mimetics that support proper folding and function

    • Solution: Systematically test detergents, nanodiscs, and liposomes with varying lipid compositions

    • Recommended protocol: Screen detergents in the following order:

      • Mild detergents: DDM, LMNG, digitonin

      • Zwitterionic: LDAO, Fos-choline

      • Reconstitution into nanodiscs with different scaffold proteins and lipid compositions

  • Functional assessment complexities:

    • Challenge: Evaluating functionality of an isolated subunit normally part of a multiprotein complex

    • Solution: Develop binding assays with partner proteins and reconstitution protocols with other PSI components

    • Validation approach: Use spectroscopic methods (CD, NMR, SAXS) to verify structural integrity before functional tests

  • Potential toxicity during expression:

    • Challenge: Expression of membrane proteins can be toxic to host cells

    • Solution: Use tightly controlled inducible promoters and optimize induction conditions

    • Monitoring strategy: Track growth curves post-induction and adjust protocols to minimize toxicity

These methodological approaches address the major challenges in obtaining functionally active recombinant psaL from T. pseudonana, drawing on successful strategies used with other challenging membrane proteins and specifically with other T. pseudonana proteins.

How can engineered variants of psaL be used to study energy transfer in diatom photosystems?

Engineered variants of T. pseudonana psaL offer powerful tools for investigating energy transfer mechanisms in diatom photosystems. The following methodological framework outlines how to effectively utilize such variants:

  • Strategic design of psaL variants:

    • Site-directed mutagenesis targets:

      • Residues at interfaces with FCPI antenna proteins

      • Amino acids near bound pigments based on structural data

      • Conserved residues identified through phylogenetic analysis

    • Fluorescent reporter introduction:

      • Insert fluorescent proteins at termini or internal permissive sites

      • Incorporate unnatural amino acids with spectroscopic properties at specific positions

      • Add specific binding sites for external fluorophores

    • Photoconvertible tag integration:

      • Engineer variants with photoactivatable proteins for tracking dynamics

      • Create temperature-sensitive variants for controlled activation

  • In vitro energy transfer studies:

    • Reconstitution systems:

      • Incorporate engineered psaL into isolated PSI cores

      • Reconstitute with purified FCPIs to form complete supercomplexes

      • Create hybrid complexes with components from different species

    • Advanced spectroscopic analysis:

      • Time-resolved fluorescence to measure energy transfer rates

      • Transient absorption spectroscopy to track excitation energy flow

      • Single-molecule FRET to analyze heterogeneity in energy transfer pathways

    • Structure-function correlation:

      • Combine spectroscopic data with structural information

      • Identify rate-limiting steps in the energy transfer process

      • Map energy transfer pathways through the complex

  • In vivo implementation using genome editing:

    • CRISPR-Cas9 knock-in strategy:

      • Replace endogenous psaL with engineered variants

      • Create libraries of psaL variants for high-throughput screening

      • Implement inducible systems for controlled expression

    • Physiological impact assessment:

      • Measure photosynthetic efficiency under various light conditions

      • Analyze growth rates and competitive fitness

      • Evaluate photoprotection capacity and light adaptation

  • Comparative analysis across conditions:

    • Environmental variable matrix:

      • Test performance across light intensities and spectral qualities

      • Evaluate energy transfer under nutrient limitation conditions

      • Assess temperature dependence of energy transfer processes

This methodological framework provides a comprehensive approach to utilizing engineered psaL variants for investigating the molecular mechanisms underlying the remarkable photosynthetic efficiency of diatoms in variable marine environments.

What can evolutionary analysis of psaL sequences tell us about diatom adaptation to marine environments?

Evolutionary analysis of psaL sequences across diatom species and other photosynthetic organisms can provide valuable insights into adaptation mechanisms to diverse marine environments. The following methodological approach outlines how to conduct such an analysis:

  • Comprehensive sequence dataset assembly:

    • Taxonomic sampling strategy:

      • Include psaL sequences from T. pseudonana and other well-studied diatoms

      • Sample across major diatom lineages (centric and pennate)

      • Include representatives from other stramenopile groups

      • Add sequences from key reference organisms (cyanobacteria, green algae, plants)

    • Data quality control:

      • Verify gene models and annotations

      • Ensure correct ortholog identification

      • Filter incomplete or potentially misannotated sequences

  • Phylogenetic analysis methods:

    • Multiple sequence alignment optimization:

      • Use structure-aware alignment algorithms

      • Manually curate transmembrane domains and functional motifs

      • Consider protein secondary structure in alignment refinement

    • Tree reconstruction approaches:

      • Maximum likelihood methods with appropriate substitution models

      • Bayesian inference for posterior probability assessment

      • Explore alternative tree topologies to assess robustness

    • Molecular clock analyses:

      • Calibrate using available fossil constraints for diatoms

      • Estimate divergence times of key psaL adaptations

      • Correlate with major oceanographic or climate events

  • Selection analysis:

    • Site-specific selection detection:

      • Implement dN/dS ratio analysis across alignment

      • Identify positively selected sites using likelihood methods

      • Map selected sites onto structural models

    • Branch-site tests:

      • Test for episodic selection on specific lineages

      • Identify adaptive changes during major ecological transitions

      • Correlate with changes in photosynthetic strategy

  • Structure-function mapping:

    • Conservation pattern visualization:

      • Map sequence conservation onto PSI-FCPI structures

      • Identify lineage-specific conserved motifs

      • Correlate conservation with protein-protein interfaces

    • Coevolution analysis:

      • Detect coevolving residues within psaL

      • Identify potential coevolution between psaL and interacting proteins

      • Infer functional constraints from coevolution networks

  • Ecological correlation analysis:

    • Habitat correlation testing:

      • Analyze psaL sequence features in relation to marine habitat parameters

      • Test for correlations with light availability, nutrient status, and temperature regimes

      • Compare adaptations between coastal and open ocean species

This multifaceted evolutionary analysis would provide insights into how psaL has been shaped by natural selection in response to the challenges of photosynthesis in marine environments, revealing the molecular basis for diatoms' ecological success.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.