Recombinant Thermanaerovibrio acidaminovorans Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant EcfT is a 269-residue transmembrane protein (UniProt ID: D1B5U2) expressed heterologously in systems such as E. coli, yeast, or mammalian cells . As part of the ECF transporter complex, EcfT acts as a scaffold, mediating interactions between substrate-specific S-components (e.g., vitamin-binding proteins) and ATP-hydrolyzing A-components . This modular architecture enables the uptake of essential micronutrients like vitamins and trace metals .

Primary Structure

The recombinant EcfT protein includes the following features:

  • Gene Locus: Taci_1151 in T. acidaminovorans .

  • Amino Acid Sequence: 1–269 residues, with a predicted molecular weight of ~30 kDa (excluding tags) .

  • Transmembrane Topology: Six transmembrane helices (TM1–TM6), forming a hydrophobic core critical for membrane integration .

Quaternary Structure

In functional ECF transporters, EcfT forms a 1:1:1:1 stoichiometric complex with two ATPases (EcfA/A') and an S-component . Structural studies reveal conformational flexibility in EcfT’s transmembrane helices, enabling adaptation to diverse S-components .

Expression and Purification

PropertyDetails
Host SystemsE. coli, yeast, baculovirus, or mammalian cells
TagN-terminal His-tag (determined during production)
Purity≥85% (SDS-PAGE verified)
StorageTris-based buffer with 50% glycerol; stable at -20°C or -80°C

Functional Motifs

  • Conserved Motifs: Ala-Arg-Gly motifs in the C-terminal region, critical for interaction with ATPases .

  • Substrate Interaction: Hydrophobic grooves in transmembrane helices facilitate S-component binding .

Genomic Context

  • Operon Organization: In T. acidaminovorans, ecfT is part of a conserved gene cluster (e.g., Taci_1151) linked to amino acid metabolism and thermophilic adaptation .

  • Phylogenetic Distribution: EcfT homologs are widespread in Synergistetes and Firmicutes, correlating with niche-specific nutrient uptake .

Biotechnological Relevance

  • Drug Discovery: ECF transporters are potential antibiotic targets due to their role in microbial survival .

  • Mechanistic Studies: Recombinant EcfT enables structural analysis of substrate-binding and ATPase coupling .

Clinical Implications

While T. acidaminovorans itself is non-pathogenic, ECF transporters in gut microbiota (e.g., Fusobacterium nucleatum) influence host-microbe interactions and chemoresistance in diseases like colorectal cancer .

  • Cryo-EM Studies: To resolve full-length EcfT in complex with ATPases and S-components.

  • Functional Mutagenesis: Testing conserved residues (e.g., Arg-71 in hinge regions) for roles in conformational transmission .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please contact your local distributors.
All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
ecfT; Taci_1151; Energy-coupling factor transporter transmembrane protein EcfT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Thermanaerovibrio acidaminovorans (strain ATCC 49978 / DSM 6589 / Su883) (Selenomonas acidaminovorans)
Target Names
ecfT
Target Protein Sequence
MSISEKVTLGQYVPADSPVHSLDPRTKILSTLVLLFALFGVRDPRFFLGWGVLLAFIVFL SRVSLRTVLRSVRPVLWLLVFTVLLHALFTPGEAILRFHFIKVSREGLHMAALMGVRLVL LVAFAGLLTLTTSPMELADGMESLMSPLARVRFPAHEMAMMMTIALRFIPTLLEETDRIL KAQISRGADLEGGGVVKRLRAFVPVLVPLFLIVFQRAEDLALAMESRCYVGGVGRTRMRP LRWCLEDWVALGLMSVSVAGLLFLERAVG
Uniprot No.

Target Background

Function
EcfT (ecfT) is the transmembrane (T) component of an energy-coupling factor (ECF) ABC-transporter complex. Unlike traditional ABC transporters, this ECF transporter provides the energy needed for the transport of various substrates.
Database Links
Protein Families
Energy-coupling factor EcfT family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of EcfT protein in Thermanaerovibrio acidaminovorans?

The Energy-coupling factor transporter transmembrane protein EcfT (ecfT) is a critical component of the ECF transporter complex in Thermanaerovibrio acidaminovorans. The full-length protein consists of 269 amino acids with the sequence beginning with MSISEKVTLGQYVPADSPVHS and continuing through a hydrophobic transmembrane region . Functionally, EcfT serves as the transmembrane component of the energy-coupling factor transporter system, facilitating substrate transport across the bacterial membrane through energy coupling mechanisms. The protein contains multiple transmembrane helices that anchor the ECF complex within the membrane, creating a pathway for substrate translocation and energy transduction. Understanding this structural arrangement is essential for interpreting its role in bacterial metabolism and potential pathogenic mechanisms.

What experimental techniques are most effective for isolating and purifying recombinant EcfT protein?

For effective isolation and purification of recombinant EcfT, a multi-step approach is recommended. Begin with optimization of expression conditions using E. coli systems with appropriate tags (His-tag is commonly effective for transmembrane proteins). When working with EcfT, the following protocol has demonstrated superior results:

  • Culture transformation with the expression vector containing the ecfT gene in an appropriate expression system

  • Induction of protein expression using optimized IPTG concentrations (typically 0.5-1.0 mM) at lowered temperatures (16-20°C)

  • Cell lysis using detergent-based methods (n-dodecyl β-D-maltoside at 1-2% concentration) to solubilize membrane proteins

  • Affinity chromatography (Ni-NTA for His-tagged constructs) with gradually increasing imidazole concentrations

  • Size exclusion chromatography to separate monomeric from aggregated protein

The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage, avoiding repeated freeze-thaw cycles . This methodological approach achieves protein purity suitable for subsequent structural and functional analyses while maintaining the native conformation of the transmembrane domains.

How can researchers verify the functional integrity of purified recombinant EcfT protein?

To verify functional integrity of purified recombinant EcfT protein, implement a multi-parametric assessment approach:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure composition

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to verify oligomeric state

    • Limited proteolysis to assess proper folding

  • Functional assays:

    • Reconstitution into proteoliposomes to measure transport activity

    • ATP hydrolysis assays to confirm energy coupling

    • Binding assays with partner proteins (S-component and EcfA/EcfA') using isothermal titration calorimetry

  • Biophysical characterization:

    • Thermal shift assays to determine protein stability

    • Intrinsic tryptophan fluorescence to monitor conformational changes

These methodological approaches provide comprehensive verification of the protein's functional state, ensuring that subsequent experimental data accurately represents the protein's native biological activities. Comparison with positive controls (e.g., other ECF transporters with known activities) provides additional validation of the functional integrity assessment.

What is the significance of Thermanaerovibrio acidaminovorans in colorectal cancer research, and how does EcfT contribute to its potential role as a diagnostic marker?

Thermanaerovibrio acidaminovorans has emerged as one of seven CRC-enriched bacteria consistently identified across diverse population cohorts, including Chinese, Austrian, American, German, and French populations . Multi-cohort metagenomic analysis involving 526 samples demonstrated that T. acidaminovorans forms part of a distinctive bacterial signature in the gut microbiome of colorectal cancer patients .

The EcfT protein may contribute to this association through several mechanisms:

  • Metabolite transport role: The ECF transporter likely mediates the uptake of specific vitamins or micronutrients that support bacterial growth in the tumor microenvironment

  • Network interactions: T. acidaminovorans participates in a mutualistic network with other CRC-enriched bacteria, suggesting coordinated metabolic activities

  • Correlation with pathogenic pathways: The presence of EcfT-containing bacteria correlates with lipopolysaccharide and energy biosynthetic pathways known to influence inflammation and tumorigenesis

The diagnostic potential is evidenced by statistical analysis showing that the seven-bacteria signature (including T. acidaminovorans) classified CRC cases from controls with an area under the receiver-operating characteristics curve (AUC) of 0.80 across different populations . This suggests EcfT-expressing bacteria could serve as a non-invasive biomarker for CRC screening, potentially contributing to a panel of microbial markers for early detection protocols.

What structural biology approaches are most suitable for determining the three-dimensional structure of EcfT, and what challenges might researchers encounter?

For determining the three-dimensional structure of EcfT, researchers should consider multiple complementary approaches:

TechniqueAdvantagesChallengesResolution Potential
X-ray CrystallographyHigh resolution atomic detailsDifficult crystallization of membrane proteins1.5-3.0 Å
Cryo-Electron MicroscopyNo crystallization required; captures different conformational statesSample preparation; preferably larger complexes2.5-4.0 Å
NMR SpectroscopySolution structure; dynamics informationSize limitations; extensive isotopic labeling3.0-5.0 Å
Molecular Dynamics SimulationConformational dynamics; interaction with lipid bilayerComputational intensity; requires validationModel-dependent

Significant challenges researchers will encounter include:

  • Expression and purification obstacles:

    • Maintaining proper folding in detergent micelles

    • Achieving sufficient protein yields for structural studies

    • Preserving native conformations during solubilization

  • Structural determination challenges:

    • Inherent flexibility of transmembrane domains

    • Capturing different functional states of the transport cycle

    • Stabilizing the protein-lipid interface

  • Methodological approaches to overcome challenges:

    • Use of fusion partners (e.g., BRIL, T4 lysozyme) to aid crystallization

    • Antibody fragment co-crystallization to stabilize flexible regions

    • Nanodiscs or lipid cubic phase crystallization for membrane environment preservation

The amino acid sequence information available for EcfT (such as MSISEKVTLGQYVPADSPVHSLDPRTKILSTLVLLFALFGVRD...) provides a starting point for structural prediction approaches using AlphaFold or RoseTTAFold algorithms prior to experimental structure determination .

How can researchers effectively design experiments to elucidate the interaction between EcfT and other components of the ECF transporter complex?

Designing experiments to elucidate EcfT interactions within the ECF transporter complex requires a systematic approach:

  • Protein-protein interaction mapping:

    • Co-immunoprecipitation with tagged EcfT to identify interaction partners

    • Bacterial two-hybrid systems optimized for membrane protein interactions

    • FRET/BRET assays to monitor interactions in near-native conditions

    • Chemical cross-linking coupled with mass spectrometry to identify interaction interfaces

  • Functional reconstitution strategies:

    • Reconstitution of purified components into proteoliposomes to assess transport activity

    • Systematic mutagenesis of predicted interaction sites followed by activity assays

    • Single-molecule FRET to capture conformational changes during the transport cycle

  • Structural biology approaches for complex characterization:

    • Co-purification of EcfT with partner proteins (EcfA, EcfA', S-component)

    • Negative-stain EM followed by cryo-EM to visualize the assembled complex

    • Hydrogen-deuterium exchange mass spectrometry to map binding interfaces

  • Computational approaches:

    • Molecular docking simulations between EcfT and partner proteins

    • Molecular dynamics simulations of the assembled complex in a lipid bilayer

    • Evolutionary coupling analysis to identify co-evolving residues across components

These methodological approaches provide complementary information about the structural and functional relationships between EcfT and other ECF transporter components, enabling researchers to build a comprehensive model of the transport mechanism.

What are the optimal experimental designs for investigating the potential role of EcfT in bacterial pathogenicity related to colorectal cancer?

To investigate EcfT's potential role in colorectal cancer-related pathogenicity, researchers should implement a multi-faceted experimental approach:

  • Genetic manipulation studies:

    • Generate ecfT knockout strains of T. acidaminovorans using CRISPR-Cas9 or homologous recombination

    • Complement with wild-type and mutant variants to confirm phenotype specificity

    • Create reporter strains with fluorescently tagged EcfT to track localization during host interaction

  • In vitro cellular models:

    • Co-culture of wild-type vs. ecfT-deficient bacteria with colorectal cell lines

    • Transwell systems to assess effects of bacterial secreted factors on epithelial integrity

    • 3D organoid models derived from normal and cancerous colorectal tissue

    • Assessment of inflammatory responses using cytokine profiling and NF-κB activation assays

  • Multi-omics approaches:

    • Transcriptomics to identify host genes affected by EcfT-expressing bacteria

    • Metabolomics to characterize changes in the microenvironment

    • Proteomics of the bacteria-host interface to identify interacting partners

  • In vivo models:

    • Colonization of gnotobiotic mice with defined bacterial communities including wild-type or ecfT-deficient strains

    • AOM/DSS colorectal cancer model to assess tumor-promoting effects

    • Patient-derived xenograft models with introduced bacterial communities

This comprehensive experimental design enables researchers to establish causal relationships between EcfT function and cancer-promoting phenotypes, while controlling for cohort-specific variations that might distort results . The approach allows for mechanistic insights at multiple biological scales, from molecular interactions to organism-level disease phenotypes.

How can researchers address data inconsistencies when studying the association between T. acidaminovorans EcfT expression and colorectal cancer across different population cohorts?

Addressing data inconsistencies in multi-cohort studies of T. acidaminovorans EcfT expression and colorectal cancer requires robust methodological approaches:

  • Standardization of metagenomic analysis pipelines:

    • Implement consistent DNA extraction protocols across cohorts

    • Use standardized sequencing depth and coverage metrics

    • Apply uniform bioinformatic pipelines with validated reference databases

    • Include synthetic spike-in controls to normalize technical variations

  • Statistical approaches for heterogeneity management:

    • Apply meta-analysis techniques with random effects models

    • Use Bayesian hierarchical modeling to account for population-specific effects

    • Implement sensitivity analyses to identify influential outliers

    • Calculate I² statistics to quantify between-study heterogeneity

  • Biological validation strategies:

    • Confirm metagenomic findings with species-specific qPCR

    • Validate protein expression using targeted proteomics

    • Perform functional assays to correlate abundance with metabolic activity

    • Isolate strains from different populations for comparative genomics

  • Covariate and confounder control:

    • Stratify analyses by demographic factors, clinical variables, and lifestyle factors

    • Match cases and controls within each cohort before cross-cohort comparison

    • Apply propensity score methods to balance confounding variables

    • Use directed acyclic graphs to identify minimal sufficient adjustment sets

These methodological approaches directly address the challenge identified in the literature that "cohort specific noises may distort the structure of microbial dysbiosis in CRC and lead to inconsistent results among studies" . By implementing rigorous standardization and statistical controls, researchers can distinguish true biological associations from technical and population-specific artifacts.

What are the recommended methods for analyzing the expression and regulation of the ecfT gene in different environmental conditions?

For comprehensive analysis of ecfT gene expression and regulation under varying environmental conditions, implement the following methodological approach:

  • Transcriptional analysis methods:

    • RT-qPCR using validated primers targeting conserved regions of the ecfT gene

    • RNA-seq with specific mapping parameters optimized for GC-rich sequences

    • 5' RACE to identify transcription start sites and potential alternative promoters

    • Northern blotting to confirm transcript size and integrity

  • Promoter characterization techniques:

    • Reporter gene assays using luciferase or fluorescent proteins fused to the ecfT promoter

    • Electrophoretic mobility shift assays (EMSA) to identify DNA-protein interactions

    • DNase I footprinting to map specific binding sites of regulatory proteins

    • ChIP-seq to identify regulatory proteins binding in vivo

  • Environmental condition testing matrix:

    • Nutrient limitation (vitamin depletion series)

    • Oxidative stress gradients

    • pH variations (acidic to alkaline)

    • Temperature range (mesophilic to thermophilic)

    • Presence of host-derived metabolites

    • Co-culture with other microbiome members

  • Data integration approaches:

    • Correlation of expression levels with metabolomic profiles

    • Network analysis to identify co-regulated genes

    • Comparative genomics across related species to identify conserved regulatory elements

This methodological framework enables researchers to comprehensively characterize the regulatory landscape of the ecfT gene, providing insights into how T. acidaminovorans modulates EcfT expression in response to environmental cues relevant to the colorectal cancer microenvironment.

What are the best approaches for studying the substrate specificity of the ECF transporter containing EcfT?

To determine substrate specificity of the ECF transporter containing EcfT, implement a systematic experimental approach combining biochemical, genetic, and computational methods:

  • Transport assays using reconstituted systems:

    • Preparation of proteoliposomes containing purified ECF complexes

    • Radiolabeled substrate uptake measurements with various potential substrates

    • Competition assays to determine relative binding affinities

    • Kinetic characterization (Km, Vmax) for identified substrates

  • Genetic approaches:

    • Growth complementation assays using auxotrophic strains

    • Adaptive laboratory evolution under substrate-limiting conditions

    • Transcriptional response analysis to substrate availability

    • Heterologous expression in model organisms with defined transport deficiencies

  • Structural biology approaches for specificity determination:

    • Co-crystallization with potential substrates

    • Hydrogen-deuterium exchange mass spectrometry to identify substrate-binding regions

    • Molecular docking simulations with substrate libraries

    • Site-directed mutagenesis of predicted binding site residues

  • Bioinformatic predictions:

    • Comparative sequence analysis with characterized ECF transporters

    • Genomic context analysis (gene neighborhood)

    • Phylogenetic profiling across bacterial species

    • Machine learning approaches trained on known ECF transporter specificities

By integrating these methodological approaches, researchers can build a comprehensive profile of the substrate range and specificity determinants of the ECF transporter containing EcfT, providing insights into its functional role in bacterial metabolism and potential contributions to host-microbe interactions in the context of colorectal cancer.

How should researchers interpret proteomics data related to EcfT abundance in clinical samples from colorectal cancer patients?

Interpreting proteomics data for EcfT abundance in clinical samples requires a structured analytical framework:

  • Data normalization and quality control:

    • Apply appropriate normalization methods (global, spike-in, or reference protein-based)

    • Implement quality filters based on coefficient of variation and detection limits

    • Account for batch effects using ComBat or similar algorithms

    • Verify peptide specificity against human protein databases to avoid misidentification

  • Statistical analysis approach:

    • Compare EcfT abundance between tumor tissue, adjacent normal tissue, and healthy controls

    • Apply paired analyses for matched samples to increase statistical power

    • Utilize appropriate tests based on data distribution (parametric vs. non-parametric)

    • Correct for multiple testing (Benjamini-Hochberg procedure recommended)

    • Implement multivariate models adjusting for clinical covariates and potential confounders

  • Biological contextualization:

    • Correlate EcfT abundance with other bacterial proteins in the same samples

    • Analyze associations with host inflammatory markers and immune signatures

    • Stratify results by cancer stage, location, and molecular subtypes

    • Compare with parallel metagenomic data when available

  • Validation strategies:

    • Confirm key findings with orthogonal methods (immunohistochemistry, targeted MS)

    • Test reproducibility in independent cohorts

    • Apply machine learning approaches to assess diagnostic potential

    • Compare with receiver operating characteristic analysis results from published studies (AUC of 0.80 reported in multicohort studies)

This comprehensive analytical framework enables robust interpretation of proteomics data on EcfT abundance, allowing researchers to distinguish true biological signals from technical artifacts and integrate findings with existing knowledge on the role of T. acidaminovorans in colorectal cancer.

What bioinformatic tools and pipelines are most appropriate for analyzing EcfT sequence variations across different bacterial strains?

For analyzing EcfT sequence variations across bacterial strains, implement a comprehensive bioinformatic pipeline:

  • Sequence acquisition and quality control:

    • Extract EcfT sequences from public databases (UniProt, NCBI) and metagenomic assemblies

    • Implement quality filters for sequence completeness and annotation reliability

    • Align sequences using MUSCLE or MAFFT with parameters optimized for transmembrane proteins

    • Perform manual curation of alignments focusing on transmembrane regions

  • Variation analysis tools and methods:

    • Calculate sequence conservation scores using ConSurf or Rate4Site

    • Identify single nucleotide polymorphisms and insertion/deletion events

    • Map variations to protein domains and functional regions

    • Apply PROVEAN or SIFT to predict functional impacts of amino acid substitutions

  • Evolutionary analysis:

    • Construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Calculate dN/dS ratios to identify signatures of selection

    • Perform ancestral sequence reconstruction

    • Apply coevolution analysis to identify functionally coupled residues

  • Structural mapping and interpretation:

    • Project sequence variations onto 3D structural models

    • Analyze clustering of variations in specific regions

    • Identify hotspots in substrate binding or protein-protein interaction interfaces

    • Use molecular dynamics simulations to assess impact on protein stability

  • Comparative genomics integration:

    • Correlate EcfT variations with bacterial genome characteristics

    • Analyze gene neighborhood conservation and synteny

    • Examine horizontal gene transfer signatures

    • Compare with variations in other ECF transporter components

This methodological pipeline enables comprehensive characterization of natural EcfT sequence diversity, providing insights into evolutionary pressures, functional constraints, and potential adaptations related to different ecological niches, including the colorectal cancer microenvironment.

What novel experimental approaches could advance our understanding of EcfT's role in bacterial adaptation to the colorectal tumor microenvironment?

Future research on EcfT's role in bacterial adaptation to colorectal tumor microenvironments should employ these innovative approaches:

  • Advanced in vitro modeling systems:

    • Microfluidic devices mimicking oxygen and nutrient gradients of tumor microenvironments

    • Patient-derived tumor organoids co-cultured with defined bacterial communities

    • Biofilm formation assays under tumor-mimicking conditions

    • Bacterial surface adherence studies using tumor-derived extracellular matrix components

  • High-resolution imaging techniques:

    • Correlative light and electron microscopy to visualize EcfT localization during host interaction

    • Super-resolution microscopy to track single-molecule dynamics in living bacteria

    • Intravital microscopy to observe bacterial behavior in animal models

    • Mass spectrometry imaging to map metabolite distributions in bacterial-tumor interfaces

  • CRISPR-based functional genomics:

    • CRISPRi/CRISPRa systems for tunable modulation of ecfT expression

    • Domain-focused mutagenesis libraries targeting specific functional regions

    • Dual bacterial-host CRISPR screens to identify interaction networks

    • Base editing approaches for precise modification of regulatory elements

  • Single-cell technologies:

    • Single-cell RNA-seq of bacteria isolated from tumor environments

    • Bacterial cytometry combined with function-specific fluorescent reporters

    • Spatial transcriptomics to map bacterial gene expression within tumor architecture

    • Microfluidic droplet-based assays for high-throughput phenotypic screening

These methodological innovations will provide unprecedented insights into the mechanisms by which EcfT contributes to bacterial adaptation in the tumor microenvironment, potentially revealing new therapeutic targets for modulating the cancer-associated microbiome.

How might researchers design clinical studies to validate the potential of T. acidaminovorans EcfT as a biomarker for colorectal cancer?

Designing clinical validation studies for T. acidaminovorans EcfT as a colorectal cancer biomarker requires rigorous methodological approaches:

  • Study design considerations:

    • Prospective cohort study with nested case-control analysis

    • Multi-center design to ensure population diversity

    • Sample size determination based on preliminary data (AUC of 0.80)

    • Inclusion of screening, diagnostic, and monitoring applications

    • Longitudinal sampling to assess temporal stability

  • Patient stratification criteria:

    • Cancer stage (early vs. advanced)

    • Anatomical location (right vs. left colon)

    • Molecular subtypes (MSI, CMS classifications)

    • Treatment history

    • Comorbidities (especially inflammatory conditions)

  • Specimen collection and processing protocols:

    • Standardized stool collection methods with preservation buffers

    • Paired tissue biopsies when available (tumor and adjacent normal)

    • Stringent quality control measures for nucleic acid extraction

    • Implementation of spike-in controls for quantification standardization

  • Detection methodology optimization:

    • Development of species-specific qPCR assays targeting ecfT

    • Digital PCR for absolute quantification

    • Targeted proteomics assays for EcfT protein

    • Integration with multi-analyte panels including other CRC-enriched bacteria

  • Clinical validation metrics:

    • Sensitivity and specificity calculation with 95% confidence intervals

    • Positive and negative predictive values in screening populations

    • Likelihood ratios for clinical decision thresholds

    • Comparison with established screening methods (FIT, colonoscopy)

    • Net reclassification improvement when added to existing risk scores

This comprehensive clinical validation framework will establish the true clinical utility of T. acidaminovorans EcfT as a non-invasive biomarker for colorectal cancer screening and diagnosis, addressing the potential for population-specific variation identified in previous research .

What are the key methodological considerations for researchers new to working with EcfT and T. acidaminovorans in colorectal cancer research?

For researchers entering the field of EcfT and T. acidaminovorans research in the context of colorectal cancer, several crucial methodological considerations should guide experimental design and interpretation:

  • Bacterial culture and manipulation:

    • T. acidaminovorans requires specialized anaerobic culture conditions with specific media formulations

    • Use of strain-specific molecular identification methods to confirm identity

    • Implementation of appropriate biosafety measures for handling clinical isolates

    • Development of genetic tools optimized for this species (vectors, transformation protocols)

  • Study design principles:

    • Include appropriate controls for host factors known to influence microbiome composition

    • Design experiments to distinguish correlation from causation

    • Account for potential confounding factors (diet, medication, etc.)

    • Implement statistical approaches to handle cohort-specific variations

  • Technical challenges and solutions:

    • Optimize DNA extraction protocols for maximum recovery from stool samples

    • Implement measures to minimize batch effects in multi-center studies

    • Develop standardized bioinformatic pipelines that can be shared across research groups

    • Establish reference materials for inter-laboratory standardization

  • Interdisciplinary collaboration requirements:

    • Engage microbiologists, oncologists, and bioinformaticians

    • Partner with clinicians for access to well-characterized patient cohorts

    • Collaborate with structural biologists for protein characterization

    • Work with immunologists to understand host-microbe interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.