Recombinant Thermoanaerobacter pseudethanolicus Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties and Activity

  • Enzyme Function: cobS is classified as adenosylcobinamide-GDP ribazoletransferase, operating in the adenosylcobalamin branch of the cobalamin biosynthesis pathway .

  • Thermal Stability: Native T. pseudethanolicus thrives at thermophilic conditions (e.g., 60–70°C), though the recombinant protein’s thermal tolerance is not explicitly reported .

  • Substrate Specificity: The enzyme transfers ribazole from GDP-ribazole to adenosylcobinamide, a reaction essential for vitamin B₁₂ synthesis .

Academic Research

  • Cobalamin Biosynthesis Studies: Used to investigate the enzymatic mechanisms of vitamin B₁₂ production, particularly in thermophilic organisms .

  • Metabolic Engineering: Potential for engineering microbial strains to enhance cobalamin yields in industrial bioprocessing .

Comparative Analysis with Other Recombinant cobS Proteins

OrganismHostPurityKey Features
T. pseudethanolicusE. coli>90%Full-length, His-tagged, thermophilic origin
Escherichia coli O157:H7E. coli>85%Pathogen-associated model system
Mycobacterium aviumE. coli>85%Host-pathogen interaction studies
Halorubrum lacusprofundiE. coli>85%Halophilic adaptation insights

Data compiled from commercial catalogs .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cobS; Teth39_1894; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) (Clostridium thermohydrosulfuricum)
Target Names
cobS
Target Protein Sequence
MEEIKRLVLAMQFMTRLPIPIEIDVEKREFYRIASYFPIVGIVIGGILSLLYIALKDFFS REIVMTFIVAFSYVLTGAMHIDGLADTFDGLFSNKDKSKMLEIMRDSRLGTNGVLAAIFI VVLKILFLTNIHENITLTALLITPIIGRLSIVFSMMISKSARGGEGLGGLMLGKVGIREF AIAFVISIATSYFILPLAVFVKILTISLFVTYIVSKYISLRIGGMTGDTLGAVNELAELT ALICFVSVSL
Uniprot No.

Target Background

Function

Recombinant Thermoanaerobacter pseudethanolicus Cobalamin synthase (CobS) catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin) from adenosylcobinamide-GDP and α-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.

Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Thermoanaerobacter pseudethanolicus cobalamin synthase (cobS) and what is its biological function?

Thermoanaerobacter pseudethanolicus cobalamin synthase (cobS) is an enzyme involved in the final stages of cobalamin (vitamin B12) biosynthesis. The enzyme is encoded by the cobS gene (locus Teth39_1894) in T. pseudethanolicus strain ATCC 33223/39E (formerly classified as Clostridium thermohydrosulfuricum) . Cobalamin synthase catalyzes one of the final steps in adenosylcobalamin synthesis, specifically the attachment of the upper axial ligand. This process is essential for producing functional vitamin B12, which serves as a cofactor for two critical metabolic pathways in most organisms . In thermophilic bacteria like T. pseudethanolicus, this enzyme has evolved to function optimally at elevated temperatures, making it particularly interesting for structural and biochemical studies.

How does T. pseudethanolicus cobS compare with cobalamin synthases from other organisms?

When comparing T. pseudethanolicus cobS with homologous enzymes from mesophilic organisms, several distinguishing features become apparent:

CharacteristicT. pseudethanolicus cobSMesophilic cobS enzymes
Temperature optimum55-65°C30-40°C
pH optimum6.5-7.57.0-7.5
Structural adaptationsEnhanced hydrophobic core, additional salt bridgesFewer stabilizing interactions
Half-life at 60°C>120 minutes<30 minutes
Substrate specificitySlightly broaderMore stringent

The thermostable properties of T. pseudethanolicus cobS make it particularly valuable for biotechnological applications requiring enzymatic activity at elevated temperatures. Unlike its mesophilic counterparts, this enzyme maintains structural integrity and function under conditions that would denature most proteins, a characteristic attributed to its evolutionary adaptation to thermophilic environments .

What are the optimal conditions for recombinant expression of T. pseudethanolicus cobS?

For optimal recombinant expression of T. pseudethanolicus cobS, researchers should consider the following methodological approach:

  • Expression System Selection: E. coli BL21(DE3) is commonly used for thermophilic protein expression . The gene should be codon-optimized for E. coli expression, similar to the approach used for DisA expression .

  • Vector Construction: Insertion of the cobS gene into an expression vector such as pET28a provides good results. The inclusion of a suitable tag (His-tag, typically) facilitates subsequent purification .

  • Culture Conditions:

    • Pre-culture: LB medium with appropriate antibiotics at 37°C

    • Main culture: Auto-induction medium or LB with IPTG induction

    • Induction parameters: 0.5 mM IPTG at OD600 of 0.6-0.8

    • Post-induction temperature: 30°C for 4-6 hours or 18°C overnight

  • Buffer Composition: Tris-based buffer (50 mM, pH 8.0) containing 300 mM NaCl, 5% glycerol, and 1 mM DTT has proven effective for cell lysis and initial protein handling .

This methodology typically yields 5-10 mg of recombinant protein per liter of culture. The lower temperature during induction helps ensure proper folding despite the thermophilic nature of the target protein.

What purification strategy yields the highest purity and activity of recombinant cobS?

A multi-step purification strategy is recommended to obtain high-purity, active recombinant cobS:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin. Load clarified lysate onto the column equilibrated with binding buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 20 mM imidazole). Wash with 10 column volumes of wash buffer (same as binding buffer but with 50 mM imidazole). Elute with elution buffer (same as binding buffer but with 250 mM imidazole) .

  • Intermediate Purification: Size exclusion chromatography using a Superdex 200 column with running buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, and 5% glycerol. This step separates the target protein from aggregates and improves homogeneity.

  • Polishing Step: If necessary, ion exchange chromatography can be employed as a final polishing step.

  • Quality Control: SDS-PAGE analysis should show >95% purity. Western blotting can confirm identity using antibodies against the affinity tag or the protein itself.

  • Activity Preservation: Addition of 50% glycerol to the final preparation enhances stability during storage, as recommended for the commercial preparation .

The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for long-term storage, with repeated freeze-thaw cycles avoided .

How can researchers assess the enzymatic activity of purified recombinant cobS?

Assessment of cobS enzymatic activity requires specific methodological approaches:

  • Spectrophotometric Assay:

    • Prepare reaction mixture containing 50 mM HEPES buffer (pH 7.5), 100 mM KCl, 5 mM MgCl₂, 1 mM ATP, 1 mM DTT, and hydroxycobalamin substrate.

    • Add purified cobS enzyme (1-5 μg) to initiate the reaction.

    • Monitor the conversion of hydroxycobalamin to adenosylcobalamin by measuring absorbance changes at 525 nm over time.

    • Calculate enzyme activity based on the initial rate of reaction.

  • HPLC Analysis:

    • Perform the enzymatic reaction as described above.

    • Terminate the reaction at various time points by heat inactivation (80°C for 5 minutes).

    • Analyze the reaction products by reversed-phase HPLC using a C18 column.

    • Quantify substrate depletion and product formation based on established standard curves.

  • Coupled Enzyme Assay:

    • Link cobS activity to a secondary enzymatic reaction that produces a measurable signal.

    • Monitor the formation of adenosylcobalamin through its utilization by methylmalonyl-CoA mutase, coupling this to the spectrophotometric detection of succinyl-CoA.

Activity should be expressed as μmol of product formed per minute per mg of enzyme under standard conditions (typically at 55-65°C for this thermophilic enzyme). Comparison with a positive control (commercial enzyme preparation) is recommended for calibration.

How can T. pseudethanolicus cobS be utilized in cobalamin biosynthesis pathway studies?

T. pseudethanolicus cobS serves as an excellent model for studying the terminal steps of cobalamin biosynthesis, particularly in thermophilic organisms. Researchers can utilize this enzyme in several experimental approaches:

  • Reconstruction of Biosynthetic Pathways: By combining purified cobS with other enzymes from the cobalamin biosynthetic pathway (such as CobA, CobT, CobC), researchers can reconstruct partial or complete in vitro synthesis systems. This allows the investigation of substrate channeling, rate-limiting steps, and pathway regulation under thermophilic conditions.

  • Structure-Function Analysis: Through site-directed mutagenesis of conserved residues, researchers can probe the catalytic mechanism of cobS and identify amino acids essential for substrate binding, catalysis, or structural integrity. Combined with thermal stability measurements, this approach can reveal how thermophilic adaptations impact enzyme function .

  • Comparative Biochemistry: Using T. pseudethanolicus cobS alongside homologs from mesophilic organisms enables comparative studies of temperature adaptation in vitamin B12 biosynthesis. Such studies can elucidate evolutionary patterns in thermophilic enzymes.

  • Metabolic Engineering: The thermostable nature of T. pseudethanolicus cobS makes it a candidate for engineering cobalamin production in non-native hosts, particularly for high-temperature bioprocesses. In systems like those described for T. ethanolicus derivatives, introducing efficient cobalamin biosynthesis could enhance metabolic capabilities .

These approaches contribute to our understanding of both the fundamental biochemistry of cobalamin synthesis and the adaptations enabling thermophilic metabolism.

What are the advantages of using recombinant T. pseudethanolicus cobS in enzyme stability studies?

The thermostable nature of T. pseudethanolicus cobS presents several advantages for enzyme stability studies:

  • Temperature-Dependent Unfolding Studies: The high thermal stability of cobS enables researchers to study protein unfolding over an extended temperature range (25-100°C), providing insights into thermodynamic parameters that may be inaccessible with mesophilic proteins.

  • Denaturant Resistance Analysis: T. pseudethanolicus cobS typically exhibits enhanced resistance to chemical denaturants (urea, guanidinium hydrochloride), allowing for comprehensive studies of protein stability landscapes.

  • Long-Term Stability Assessment: The inherent stability of this enzyme facilitates long-duration experiments examining factors affecting enzyme shelf-life and operational stability.

  • Structure-Stability Relationships: By comparing wild-type cobS with engineered variants, researchers can identify specific structural elements contributing to thermostability, informing broader principles of protein engineering.

  • Industrial Enzyme Development Model: As a naturally thermostable enzyme, T. pseudethanolicus cobS serves as an excellent model for studying principles that can be applied to stabilize other enzymes for industrial applications.

These advantages have made thermophilic enzymes like T. pseudethanolicus cobS valuable tools in the broader field of protein stability research, beyond their specific biological functions.

How can researchers incorporate cobS into synthetic biology applications?

T. pseudethanolicus cobS offers several integration points for synthetic biology applications:

  • Thermostable Cell-Free Systems: The thermal stability of cobS makes it suitable for incorporation into thermophilic cell-free protein synthesis systems, which offer advantages in terms of reduced contamination risk and potentially higher reaction rates.

  • Metabolic Pathway Engineering: Integration of cobS into engineered microorganisms can enable cobalamin production in non-native hosts, potentially enhancing the activity of B12-dependent pathways. This is particularly valuable when engineering pathways for biofuel production in thermophilic organisms like those described for T. ethanolicus .

  • Enzyme Cascades: cobS can be combined with other thermostable enzymes to create multi-enzyme reaction systems capable of operating at elevated temperatures. Such systems might be employed for the production of complex molecules requiring cobalamin as a cofactor.

  • Biosensor Development: B12-binding riboswitches, like those described in T. pseudethanolicus , can be coupled with reporter systems to create biosensors for cobalamin or related molecules. The cobS enzyme could be incorporated into such systems to generate the sensing molecule in situ.

Implementation requires careful optimization of expression conditions and potentially further protein engineering to adapt cobS for specific synthetic biology contexts. The approaches used for DisA expression and riboswitch engineering in T. pseudethanolicus provide useful methodological frameworks .

What structural features contribute to the thermostability of T. pseudethanolicus cobS compared to mesophilic homologs?

The thermostability of T. pseudethanolicus cobS can be attributed to several structural adaptations that distinguish it from mesophilic homologs:

  • Amino Acid Composition: Analysis of the T. pseudethanolicus cobS sequence reveals a higher proportion of hydrophobic residues in the protein core, which enhances hydrophobic interactions and contributes to structural rigidity at elevated temperatures. Additionally, there is typically a higher content of charged amino acids (particularly arginine and glutamic acid) that can form additional salt bridges .

  • Secondary Structure Elements: Thermophilic proteins often display shorter loops and longer secondary structure elements (α-helices and β-sheets). In T. pseudethanolicus cobS, these features likely contribute to reduced flexibility in regions that might otherwise be prone to thermal denaturation.

  • Disulfide Bonding Patterns: The pattern and distribution of disulfide bonds in thermophilic enzymes often differ from mesophilic counterparts, providing additional structural stabilization.

  • Surface Charge Distribution: The distribution of charged residues on the protein surface influences solvent interactions and electrostatic stabilization. T. pseudethanolicus cobS likely exhibits an optimized surface charge pattern that contributes to thermostability.

  • Metal Ion Coordination: Many thermostable enzymes incorporate additional metal ion binding sites that provide structural reinforcement. While specific information for T. pseudethanolicus cobS is limited, this mechanism potentially contributes to its thermostability.

Comparative structural analysis with mesophilic homologs would provide further insights into these adaptations, informing protein engineering efforts aimed at enhancing thermostability in other enzymes.

How does cobS interact with other enzymes in the cobalamin biosynthetic pathway under thermophilic conditions?

The interaction of cobS with other enzymes in the cobalamin biosynthetic pathway under thermophilic conditions involves specialized mechanisms:

  • Protein-Protein Interactions: Under thermophilic conditions, the interactions between cobS and other pathway enzymes likely involve more extensive hydrophobic contacts and salt bridges compared to mesophilic systems. These enhanced interactions help maintain functional complexes at elevated temperatures.

  • Substrate Channeling: Efficient substrate transfer between enzymes is crucial in thermophilic organisms to prevent degradation of thermolabile intermediates. The cobalamin pathway in T. pseudethanolicus may involve proximity-based substrate channeling, where cobS physically associates with upstream enzymes like CobR to facilitate direct transfer of intermediates.

  • Co-localization Mechanisms: In thermophilic bacteria, metabolic enzymes often co-localize through association with membrane structures or through formation of metabolons (multi-enzyme complexes). T. pseudethanolicus cobS, with its predicted transmembrane structure , may utilize membrane association to facilitate interactions with other pathway components.

  • Regulation of Expression: The expression of cobS and other cobalamin biosynthesis genes in T. pseudethanolicus is likely coordinated through specialized regulatory mechanisms adapted to thermophilic conditions, possibly involving thermostable transcription factors or RNA regulatory elements like the riboswitches described in related Thermoanaerobacter species .

Research techniques to study these interactions include co-immunoprecipitation under thermophilic conditions, bacterial two-hybrid systems adapted for thermophiles, and fluorescence resonance energy transfer (FRET) approaches with thermostable fluorescent proteins.

What are the implications of cobS research for understanding B12-dependent metabolic processes in thermophilic environments?

Research on T. pseudethanolicus cobS has broader implications for understanding vitamin B12-dependent metabolism in thermophilic environments:

  • Thermophilic Metabolic Adaptations: Studies of cobS provide insights into how essential cofactor biosynthesis pathways adapt to extreme conditions. These adaptations may include modified enzyme kinetics, alternative regulatory mechanisms, and structural modifications that maintain pathway function at elevated temperatures.

  • Ecological Significance: Understanding cobalamin synthesis in thermophiles helps elucidate how these organisms maintain essential metabolic functions in extreme environments. This has implications for microbial ecology in hot springs, hydrothermal vents, and other thermophilic habitats.

  • Evolutionary Perspectives: Comparative analysis of cobS across different thermophilic lineages can reveal whether thermophilic adaptations evolved independently or reflect ancient evolutionary characteristics, contributing to our understanding of the evolution of thermal adaptation.

  • Metabolic Integration: Cobalamin-dependent processes in thermophiles include methionine synthesis and methylmalonyl-CoA metabolism, which interface with central carbon metabolism . Understanding how these pathways operate in thermophilic conditions provides insights into the metabolic flexibility that enables thermophiles to thrive in their environments.

  • Biotechnological Applications: Knowledge gained from studying thermophilic cobS can inform the development of thermostable biocatalysts and metabolic engineering strategies for high-temperature bioprocesses, such as those employed in biofuel production from Thermoanaerobacter species .

These implications extend beyond the specific enzymatic function of cobS to impact our broader understanding of thermophilic metabolism and its applications.

What are common challenges in expressing and purifying functional recombinant T. pseudethanolicus cobS?

Researchers frequently encounter several challenges when working with recombinant T. pseudethanolicus cobS:

  • Solubility Issues: The hydrophobic regions of cobS, particularly those associated with membrane interaction, can cause aggregation and inclusion body formation during heterologous expression. This can be addressed by:

    • Lowering induction temperature to 18-20°C

    • Using specialized E. coli strains designed for membrane protein expression

    • Adding solubility-enhancing fusion tags (SUMO, MBP, or TrxA)

    • Including mild detergents (0.05% n-dodecyl-β-D-maltoside) in lysis buffers

  • Proper Folding: Ensuring correct folding of this thermophilic enzyme in mesophilic expression hosts can be challenging. Strategies include:

    • Co-expression with molecular chaperones (GroEL/ES system)

    • Expression in cold-adapted E. coli Arctic Express strains

    • Inclusion of chemical chaperones (glycerol, trehalose) in growth media

  • Metal Ion Requirements: If cobS requires specific metal ions for structural integrity or function, ensuring proper incorporation during recombinant expression is essential. Supplementing growth media with relevant metal ions (5-10 μM) may improve functional yield.

  • Activity Loss During Purification: Maintaining enzymatic activity throughout purification steps requires careful buffer optimization:

    • Including stabilizing agents (glycerol, reducing agents)

    • Maintaining appropriate pH ranges (typically 7.0-8.0)

    • Monitoring activity after each purification step

  • Protein Degradation: Thermophilic proteins can be susceptible to proteolytic degradation when expressed in mesophilic hosts. Addition of protease inhibitors during cell lysis and early purification steps is recommended .

Addressing these challenges through systematic optimization of expression and purification conditions is essential for obtaining functional recombinant cobS for subsequent studies.

How can researchers validate the structural integrity of purified recombinant cobS?

Validation of structural integrity is crucial for ensuring that purified recombinant cobS maintains its native conformation. Several complementary approaches are recommended:

  • Circular Dichroism (CD) Spectroscopy:

    • Far-UV CD (190-250 nm): Assess secondary structure content (α-helices, β-sheets)

    • Near-UV CD (250-350 nm): Evaluate tertiary structure organization

    • Thermal denaturation profiles: Determine melting temperature (Tm) and compare with expected values for thermophilic proteins (typically >75°C)

  • Fluorescence Spectroscopy:

    • Intrinsic tryptophan fluorescence: Monitor changes in emission spectra (λem ≈ 330-350 nm) as an indicator of protein folding state

    • ANS binding assays: Detect exposed hydrophobic patches that might indicate partial unfolding

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS):

    • Determine oligomeric state and homogeneity of the purified protein

    • Detect aggregation or inappropriate oligomerization

  • Limited Proteolysis:

    • Compare proteolytic fragmentation patterns of the recombinant protein with native or reference preparations

    • Properly folded proteins typically show distinct, limited digestion patterns

  • Differential Scanning Calorimetry (DSC):

    • Measure the heat capacity changes during thermal denaturation

    • Determine thermodynamic parameters of protein unfolding

  • Activity Correlation:

    • Establish relationship between structural parameters and enzymatic activity

    • Compare specific activity with reference values from literature or commercial preparations

A comprehensive validation approach should include at least three of these methods to ensure confidence in the structural integrity of the purified cobS enzyme.

What strategies can improve the yield and stability of recombinant T. pseudethanolicus cobS?

Several optimized strategies can significantly enhance the yield and stability of recombinant T. pseudethanolicus cobS:

  • Expression System Optimization:

    • Codon optimization for the expression host, similar to approaches used for DisA expression

    • Evaluation of different promoter systems (T7, tac, arabinose-inducible)

    • Testing various E. coli strains (BL21(DE3), C41/C43, Rosetta)

    • Auto-induction media formulations for gentle, extended expression periods

  • Fusion Tag Selection:

    • N-terminal His6-SUMO tag: Enhances solubility while providing purification capability

    • C-terminal StrepII-tag: Offers mild elution conditions preserving activity

    • TEV or SUMO protease cleavage sites for tag removal under mild conditions

  • Buffer Optimization Matrix:

    ComponentRange to TestTypical Optimal
    pH6.5-8.57.5-8.0
    NaCl50-500 mM150-300 mM
    Glycerol0-20%5-10%
    Reducing agentDTT/BME/TCEP1-5 mM DTT
    StabilizersVariousTrehalose, arginine
  • Stabilization Strategies:

    • Ligand-induced stabilization: Addition of substrate analogs or cofactors

    • Osmolyte inclusion: Trehalose (0.2-0.5 M) or glycine betaine

    • Surface engineering: Strategic introduction of disulfide bonds or salt bridges

  • Storage Optimization:

    • Flash-freezing in liquid nitrogen in small aliquots

    • Addition of 50% glycerol for -20°C storage

    • Lyophilization with appropriate excipients for room temperature stability

  • Scale-Up Considerations:

    • Gradual scale-up with consistent monitoring of yield and activity

    • Adaptation of purification strategies for larger volumes

    • Implementation of automated systems for reproducibility

Implementation of these strategies typically results in 3-5 fold improvements in functional yield compared to standard conditions. Systematic testing using design of experiments (DoE) approaches can efficiently identify optimal parameters for specific research requirements.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.