Recombinant Thermoanaerobacter pseudethanolicus UPF0365 protein Teth39_1136 (Teth39_1136)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
floA; Teth39_1136; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-329
Protein Length
full length protein
Species
Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) (Clostridium thermohydrosulfuricum)
Target Names
Teth39_1136
Target Protein Sequence
MTEFIFLLVVIGLIFVFLSVILSFIPLGLWISALAAGVKIGIFTLVGMRLRRVPPDKIVK PLIKAIKAGQDVEINKLEAHYLAGGNVDKVIDALIAAQRANISLEFERAAAIDLAGRDVL HAVQMSVNPKVIETPVVAAVAKDGIEVKVKARVTVRANIDRLVGGAGEETIIARVGEGIV TTVGSSNSHKEVLENPDSISRTVLNKGLDAGTAFEILSIDIADVDVGRNIGARLQIDQAE ADKRIAQAKAEERRAMAVAREQEMKAMVQEMRAKVVEAEAEVPKAMAEALRTGKIGVMDY YNMRNVIADTMMRESFSKLGQERQQEEKE
Uniprot No.

Target Background

Function

Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are believed to play a crucial role in maintaining membrane fluidity.

Database Links
Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for this recombinant protein?

The recombinant Teth39_1136 protein requires careful storage to maintain structural integrity and biological activity. According to manufacturer specifications, upon receipt, the protein should be stored at -20°C or -80°C . For proteins stored as stock solutions, aliquoting is essential to prevent repeated freeze-thaw cycles, which can lead to protein degradation and loss of activity. Working aliquots may be stored at 4°C for up to one week .

Storage recommendations based on form:

  • Lyophilized form: Store at -20°C/-80°C

  • Reconstituted form: Aliquot and store with glycerol (recommended final concentration 50%) at -20°C/-80°C

The recommended storage buffer consists of a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . This buffer composition helps maintain protein stability during freeze-thaw cycles. When designing experiments, researchers should always consider the stability profile of the protein under their specific experimental conditions, particularly given its thermophilic origin.

What reconstitution protocol should be followed for optimal protein activity?

For optimal reconstitution of the lyophilized protein, follow this methodological approach:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is the manufacturer's standard recommendation)

  • Prepare aliquots of appropriate volumes for your experimental needs

  • Store reconstituted aliquots at -20°C/-80°C for long-term storage

When selecting reconstitution conditions, consider the downstream applications. Different buffer systems may be required depending on whether the protein will be used for enzymatic assays, structural studies, or protein-protein interaction experiments. The addition of glycerol serves as a cryoprotectant, preventing ice crystal formation that could damage protein structure during freezing.

How should researchers design controls when working with His-tagged Teth39_1136?

Appropriate experimental controls are critical when working with recombinant His-tagged proteins like Teth39_1136. Consider implementing the following control strategies:

  • Negative controls:

    • Buffer-only conditions to establish baseline measurements

    • Irrelevant protein of similar size with the same tag to control for tag-specific effects

    • Heat-denatured Teth39_1136 to distinguish specific from non-specific activities

  • Positive controls:

    • Known interacting partner of flotillin-like proteins (if available)

    • Activity standards relevant to your specific assay

  • Tag interference controls:

    • When possible, compare with an untagged version of the protein

    • Use proteins with alternative tag positions (C-terminal vs. N-terminal)

    • Include tag removal conditions using appropriate proteases if the construct contains a cleavage site

These controls help distinguish between effects attributable to the protein of interest versus those related to the experimental system or the His-tag itself. Statistical comparison between these controls is essential for robust data interpretation, following principles of good experimental design that minimize variability within treatments .

What factors should be considered when designing thermal stability experiments?

Given the thermophilic origin of Teth39_1136, thermal stability experiments require special considerations:

  • Temperature range selection:

    • Begin with a broad temperature range (25-95°C) to capture the full stability profile

    • Use narrower increments (5°C steps) around expected transition temperatures

    • Include temperatures relevant to both the native organism's environment and standard laboratory conditions

  • Assay selection:

    • Differential Scanning Fluorimetry (DSF) for initial thermal stability profiling

    • Circular Dichroism (CD) spectroscopy to monitor secondary structure changes

    • Activity assays at various temperatures to correlate structural stability with function

  • Buffer considerations:

    • Test multiple buffer systems as they can significantly affect thermal stability

    • Include physiologically relevant ions and cofactors

    • Evaluate pH stability across the temperature range (note that pH of some buffers is temperature-dependent)

  • Data analysis approach:

    • Calculate the melting temperature (Tm) using appropriate curve-fitting models

    • Compare cooperative versus non-cooperative unfolding transitions

    • Analyze the reversibility of thermal denaturation through cooling and reheating cycles

These methodological considerations help ensure that thermal stability assessments of Teth39_1136 are reliable and biologically relevant. The data should be analyzed using appropriate statistical methods that account for experimental variability .

What methods are most appropriate for investigating the membrane association properties of Teth39_1136?

Given that Teth39_1136 is annotated as a flotillin-like protein (floA) , researchers should employ multiple complementary techniques to characterize its membrane association properties:

  • Membrane fractionation studies:

    • Differential ultracentrifugation to separate membrane fractions

    • Detergent resistance membrane (DRM) isolation to assess lipid raft association

    • Density gradient separation to distinguish between different membrane compartments

  • Microscopy-based techniques:

    • Immunofluorescence microscopy with membrane markers

    • FRET analysis with known membrane proteins

    • Super-resolution microscopy (STORM/PALM) for nanoscale localization

  • Biophysical approaches:

    • Surface Plasmon Resonance (SPR) with reconstituted liposomes

    • Atomic Force Microscopy (AFM) of protein-membrane interactions

    • Fluorescence Recovery After Photobleaching (FRAP) to assess mobility within membranes

  • Computational methods:

    • Molecular dynamics simulations of membrane insertion

    • Hydrophobic moment analysis of the protein sequence

    • Structural modeling of protein-membrane interfaces

Each of these methods provides different insights into membrane association, and researchers should apply multiple approaches to build a comprehensive understanding of Teth39_1136's membrane interactions. Statistical analysis of these experiments should account for both biological and technical variability .

What approaches can be used to characterize protein-protein interactions involving Teth39_1136?

To investigate the protein interaction network of Teth39_1136, researchers should consider a multi-faceted approach:

  • In vitro methods:

    • Pull-down assays using the His-tag as an affinity handle

    • Surface Plasmon Resonance (SPR) for kinetic and affinity measurements

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

    • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS) for complex stoichiometry

  • Structural approaches:

    • X-ray crystallography of complexes

    • Cryo-electron microscopy for larger assemblies

    • NMR spectroscopy for mapping interaction interfaces

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) for conformational changes upon binding

  • Computational methods:

    • Molecular docking simulations

    • Coevolution analysis to predict interaction partners

    • Protein-protein interaction network analysis

  • Quantitative analysis frameworks:

    • Determine binding affinities (Kd values)

    • Assess binding stoichiometry

    • Evaluate thermodynamic parameters (ΔH, ΔS, ΔG)

    • Measure association and dissociation rate constants (kon, koff)

For each interaction identified, researchers should apply multiple orthogonal methods for validation. Statistical significance should be established through appropriate experimental replication and controls .

How should researchers analyze variability in experimental results with Teth39_1136?

When working with recombinant proteins like Teth39_1136, variability can arise from multiple sources. Researchers should address this systematically:

  • Sources of variability:

    • Protein batch-to-batch differences

    • Experimental conditions (temperature, pH, buffer composition)

    • Instrument calibration and measurement error

    • Sample handling and preparation techniques

  • Statistical approaches:

    • Calculate both measures of central tendency (mean, median) and variability (standard deviation, interquartile range)

    • Use variance components analysis to identify major sources of variability

    • Apply appropriate transformations if data violate normality assumptions

  • Experimental design considerations:

    • Include biological replicates (different protein preparations)

    • Include technical replicates (repeated measurements of the same sample)

    • Use randomization and blocking designs to control for confounding variables

  • Reporting recommendations:

    • Clearly distinguish between technical and biological variability

    • Report both raw data and derived parameters

    • Include appropriate error bars and statistical significance measures

Careful attention to variability not only improves data quality but also enhances the power to detect true experimental effects. As noted in the statistical literature, "two factors are commonly involved in assessing the effects of an experimental variable: a measure of centrality, such as the mean, median, or proportion; and a measure of variability, such as the standard deviation" .

What statistical methods are appropriate for comparing wild-type versus recombinant Teth39_1136 properties?

When comparing properties between wild-type and recombinant versions of Teth39_1136, researchers should select statistical methods based on their experimental design and data characteristics:

  • For continuous measurements (e.g., activity rates, binding affinities):

    • Paired t-tests for direct comparisons of matched samples

    • ANOVA for comparisons involving multiple conditions

    • Non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) for non-normally distributed data

  • For categorical or binary outcomes:

    • Chi-square tests for frequency data

    • Fisher's exact test for small sample sizes

    • Logistic regression for multivariate analysis

  • Effect size quantification:

    • Cohen's d for standardized mean differences

    • Percent change relative to wild-type

    • Area Under the Curve (AUC) for time-course data

  • Advanced analytical frameworks:

    • Mixed-effects models for nested or repeated measures designs

    • Bayesian approaches for incorporating prior knowledge

    • Power analysis to determine appropriate sample sizes

Considering that "control over variability is possible" and that "much of [experimental design] focuses, directly or indirectly, on procedures for reducing variability" , researchers should implement standardized protocols that minimize experimental noise. This approach increases the sensitivity to detect true differences between wild-type and recombinant forms of the protein.

What techniques are recommended for elucidating the physiological role of Teth39_1136?

Understanding the physiological function of Teth39_1136 requires a comprehensive experimental strategy:

  • Genetic approaches:

    • Gene knockout/knockdown studies in Thermoanaerobacter pseudethanolicus (if genetic tools are available)

    • Heterologous expression in model organisms

    • Complementation studies to confirm phenotype specificity

  • Biochemical characterization:

    • Activity assays based on predicted function

    • Substrate specificity profiling

    • Post-translational modification analysis

    • Structure-function relationship studies

  • Systems biology approaches:

    • Transcriptomic analysis to identify co-regulated genes

    • Proteomic studies to map interaction networks

    • Metabolomic profiling to identify pathway involvement

  • Comparative analysis:

    • Phylogenetic profiling across species

    • Domain conservation assessment

    • Structural comparison with functionally characterized homologs

These approaches should be integrated to build a cohesive model of Teth39_1136 function. Statistical analysis of these multifaceted datasets requires appropriate methods for data integration and interpretation .

How can researchers address potential artifacts introduced by the recombinant expression system?

Recombinant expression in E. coli can introduce artifacts that affect protein characteristics. Researchers should implement methodologies to identify and mitigate these issues:

  • Expression system artifacts:

    • Codon usage differences between E. coli and Thermoanaerobacter pseudethanolicus

    • Lack of native post-translational modifications

    • Potential misfolding due to different chaperone systems

    • Formation of inclusion bodies or soluble aggregates

  • Mitigation strategies:

    • Optimize codon usage for E. coli expression

    • Explore alternative expression hosts (thermophilic bacteria if available)

    • Co-express with relevant chaperones

    • Test different induction conditions and temperatures

    • Implement on-column refolding protocols during purification

  • Validation approaches:

    • Circular Dichroism to confirm proper secondary structure

    • Mass spectrometry to verify protein integrity

    • Functional assays to confirm biological activity

    • Thermal stability analysis to compare with predicted thermophilic properties

  • Analytical considerations:

    • Native PAGE to assess oligomeric state

    • Size-exclusion chromatography to detect aggregation

    • Dynamic light scattering to determine size distribution

By systematically addressing potential artifacts, researchers can ensure that their findings reflect the true properties of Teth39_1136 rather than artifacts of the expression system. This approach aligns with principles of reducing experimental variability to increase sensitivity to treatment effects .

What structural biology techniques are suitable for characterizing Teth39_1136?

Elucidating the structure of Teth39_1136 requires a strategic selection of complementary techniques:

These techniques should be applied in a strategic sequence, with initial lower-resolution approaches guiding more resource-intensive high-resolution studies. Statistical analysis of structural data should consider experimental uncertainties and ensemble representations where appropriate .

How can researchers integrate multiple experimental approaches for comprehensive characterization of Teth39_1136?

A comprehensive research strategy for Teth39_1136 should integrate structural, functional, and evolutionary perspectives:

  • Multi-scale analysis framework:

    • Molecular level: Structure, dynamics, and interactions

    • Cellular level: Localization, complex formation, and pathway involvement

    • Organism level: Physiological role and phenotypic effects

    • Evolutionary level: Conservation, specialization, and adaptation

  • Data integration strategies:

    • Correlation analysis between structural features and functional properties

    • Network approaches to connect protein interactions with cellular pathways

    • Machine learning methods to identify patterns across diverse datasets

  • Validation through orthogonal methods:

    • Confirm key findings using techniques based on different physical principles

    • Test predictions through targeted experiments

    • Compare in vitro results with in vivo observations when possible

  • Collaborative research model:

    • Engage specialists across different technical domains

    • Implement standardized protocols for cross-laboratory comparisons

    • Develop shared resources and data repositories

By integrating diverse experimental approaches and properly accounting for variability in each method, researchers can build a comprehensive understanding of Teth39_1136 that spans from atomic structure to physiological function. This integrated approach maximizes the value of the recombinant protein as a research tool while minimizing the impact of artifacts or limitations of any single technique .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.