Recombinant Thermoanaerobacter sp. Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

Recombinant Thermoanaerobacter sp. Cobalamin synthase (cobS) is a full-length, enzymatically active protein engineered for research and biotechnological applications. The enzyme, encoded by the cobS gene (UniProt ID: B0K2K2), catalyzes critical steps in cobalamin (vitamin B12) biosynthesis, a process essential for microbial metabolism, particularly in anaerobic environments. The recombinant form is produced in Escherichia coli as an N-terminal His-tagged fusion protein (1–250 amino acids) to facilitate purification and structural studies .

Functional Role

Cobalamin synthases (cobS) are central to cobamide biosynthesis, converting intermediates like adenosylcobinamide phosphate (AdoCbi-P) into active cofactors like cobalamin (Cbl). In Thermoanaerobacter spp., this enzyme supports metabolic pathways in thermophilic, anaerobic environments, such as acetogenesis and fermentation .

Biosynthesis and Enzyme Activity

  • Cobalamin Synthesis: cobS catalyzes the assembly of the lower ligand (e.g., adenine, methyl, or cyanide groups) onto the corrinoid core, enabling the conversion of pre-corrinoids into functional B12 derivatives .

  • Thermophilic Adaptation: Thermoanaerobacter spp. thrive at elevated temperatures (50–80°C), and their cobS enzymes are likely optimized for stability under such conditions. For example, structural studies on related enzymes (e.g., amylopullulanase in Thermoanaerobacter pseudoethanolicus) suggest that C-terminal regions may influence thermostability .

Table 2: Comparative cobS Enzymes from Other Organisms

OrganismGene IDKey FeaturesSource
Methanothermobacter thermautotrophicusMTH1112Methanogenic archaeon; cobalamin-dependent metabolism
Vibrio choleraeNot listedCobamide remodeling via cobS; substrate promiscuity
Thermococcus onnurineusNot listedHyperthermophilic; cobS activity in extreme environments

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. To ensure optimal stability, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
cobS; Teth514_0306; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Thermoanaerobacter sp. (strain X514)
Target Names
cobS
Target Protein Sequence
MEEIKRLVLAMQFMTHLPIPIEIDVEKSEFYKIASYFPIVGIVIGGILSLFYIALKDFFS REIVMTFIVAFSYVLTGAMHIDGLADTFDGLFSNKDKSKMLEIMRDSRLGTNGVLALVFM VVLKILFLTNINENITLTALLITPIIGRLSIVFSMMITKSARGGEGLGGLMLGKVGIREF AIAFVISIATSYFILPLAVFVKILTISLFVTYIVSKYISLRIGGMTGDTLGAVNELAELT ALICFVSVSL
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from Thermoanaerobacter sp. catalyzes the final two steps in cobalamin biosynthesis. It joins adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). Additionally, it synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Thermoanaerobacter sp. and why is it significant for cobalamin research?

Thermoanaerobacter species are thermophilic, anaerobic, Gram-positive, spore-forming bacteria that have been isolated from geothermal springs and similar environments. These organisms can grow at temperatures between 40-80°C, with optimal growth typically occurring around 65-70°C . Their thermophilic nature makes them particularly interesting for studying heat-stable enzymes involved in essential metabolic processes, including cobalamin (vitamin B12) biosynthesis. Thermoanaerobacter species possess diverse metabolic capabilities, including the fermentation of various carbohydrates and the utilization of carbon monoxide, producing end products such as lactate, acetate, ethanol, hydrogen, and carbon dioxide . This metabolic versatility, coupled with their growth at high temperatures, makes them valuable model organisms for studying cobalamin biosynthesis under extreme conditions.

What is the role of cobalamin synthase (cobS) in vitamin B12 biosynthesis?

Cobalamin synthase (cobS) catalyzes one of the final steps in the biosynthesis of vitamin B12 (cobalamin), specifically the attachment of the upper axial ligand to the corrin ring structure. This enzyme belongs to the broader family of cobamide biosynthesis proteins, which are essential for producing the vitamin B12 family of cobalt-containing cofactors. Cobamides are required for metabolism in all domains of life, including most bacteria . The cobS enzyme is particularly crucial because it contributes to the formation of the complete cobalamin structure, which serves as an essential cofactor for various enzymes involved in methylation reactions, isomerization reactions, and methionine synthesis. In Thermoanaerobacter species, the thermostable nature of cobS potentially offers unique structural and functional properties compared to mesophilic counterparts.

Why study recombinant cobS from Thermoanaerobacter species?

Studying recombinant cobS from Thermoanaerobacter species offers several research advantages:

  • Thermostability: The enzyme's stability at high temperatures makes it potentially valuable for industrial applications requiring robust biocatalysts.

  • Unique structural insights: The thermostable version of cobS may reveal structural adaptations that contribute to protein stability under extreme conditions.

  • Evolutionary perspective: Comparison with mesophilic cobS enzymes provides insights into the evolution of vitamin B12 biosynthesis pathways.

  • Biotechnological applications: Thermostable cobS could potentially be engineered for improved vitamin B12 production or modified cobamide structures.

  • Model system: Thermoanaerobacter species serve as model organisms for understanding anaerobic, thermophilic metabolism, including essential cofactor biosynthesis.

What are the general characteristics of cobamide biosynthesis pathways in bacteria?

Cobamide biosynthesis in bacteria involves a complex pathway with approximately 30 enzymatic steps. Cobamides comprise the vitamin B12 family of cobalt-containing cofactors and are required for metabolism in all domains of life . There are two main routes for cobamide biosynthesis: the aerobic pathway (found in organisms like Pseudomonas denitrificans) and the anaerobic pathway (found in organisms like Thermoanaerobacter species). These pathways differ mainly in the timing of cobalt insertion and the mechanism of corrin ring formation.

Cobamides exhibit structural variability in the lower ligand, and selectivity for particular cobamides has been observed in most organisms studied to date . This variability is significant because different microorganisms often require specific cobamide structures for their metabolic functions. Some bacteria, including Thermoanaerobacter species, have evolved mechanisms to modify or "remodel" cobamides obtained from their environment to suit their specific metabolic needs.

What genetic systems are available for modifying Thermoanaerobacter species?

Recent research has established genetic systems for thermophilic acetogenic bacteria like Thermoanaerobacter kivui . These systems leverage the natural competence for DNA uptake observed in Thermoanaerobacter species, which primarily occurs during the mid-exponential growth phase, unlike related species where highest transformation frequencies are observed in early exponential phase .

Key components of genetic modification systems for Thermoanaerobacter include:

  • Natural competence machinery: Genes such as comEA (TKV_RS04530), comEC1 (TKV_RS04705), comEC2 (TKV_RS11745), and recA (TKV_RS06255) are involved in natural DNA uptake .

  • Selection markers: Kanamycin resistance has been successfully used for selection in Thermoanaerobacter.

  • Markerless deletion systems: Using pyrE as a counterselection marker with 5-fluoroorotic acid (5-FOA) resistance.

  • Homologous recombination: Integration of plasmid DNA into the genome via both single and double homologous recombination events .

This genetic toolkit provides the foundation for expressing recombinant cobS and studying its function in either native or heterologous hosts.

What are optimal expression systems for recombinant Thermoanaerobacter cobS?

When expressing recombinant cobS from Thermoanaerobacter species, researchers should consider the following expression systems and optimization strategies:

Expression SystemAdvantagesChallengesKey Considerations
Homologous expression (Thermoanaerobacter)Native cellular environment, proper foldingAnaerobic cultivation requirements, lower yieldsUse established genetic systems , optimize promoters
E. coliWell-established, high yieldsPotential misfolding of thermophilic proteinsUse chaperone co-expression, optimize codons
Thermophilic hosts (e.g., Thermus thermophilus)Similar growth temperature, better foldingLess developed genetic toolsAdapt Thermoanaerobacter genetic systems
Cell-free systemsAvoid toxicity issues, rapid optimizationLimited post-translational modificationsMaintain anaerobic conditions during synthesis

For Thermoanaerobacter itself, promoters like Pkan or the gyrase promoter from Thermoanaerobacter sp. strain X514 (PgyrX514) have been successfully used for gene expression , and could potentially drive cobS expression.

How can researchers optimize recombinant cobS activity and stability?

To optimize recombinant cobS activity and stability, researchers should consider these key factors:

  • Temperature optimization: Since Thermoanaerobacter species grow optimally at 65-70°C , recombinant cobS is likely to have maximum activity and stability at similar temperatures.

  • Anaerobic expression: Maintain strict anaerobic conditions during expression, as Thermoanaerobacter species are obligate anaerobes and oxygen exposure may affect protein folding and activity.

  • Metal cofactor incorporation: Ensure sufficient cobalt availability in expression media, as cobS is involved in incorporating this metal into the corrin ring structure.

  • pH optimization: Thermoanaerobacter species typically prefer pH 6.3-6.8 , suggesting cobS may have optimal activity in this range.

  • Fusion tags: Consider thermostable fusion partners that can enhance solubility without compromising the thermostability of cobS.

  • Chaperone co-expression: When expressing in mesophilic hosts, co-express thermophilic chaperones to assist in proper folding.

What cloning strategies are most effective for Thermoanaerobacter cobS?

Based on established genetic systems for Thermoanaerobacter species, the following cloning strategies have proven effective:

  • Plasmid-based expression: Using vectors with origins of replication functional in Thermoanaerobacter, such as those derived from Thermoanaerobacterium thermosaccharolyticum .

  • Genomic integration: Homologous recombination-based integration into the Thermoanaerobacter genome using flanking regions to target specific loci .

  • Gibson Assembly: This method has been successfully employed for constructing Thermoanaerobacter expression vectors and is particularly useful for thermophilic genes due to its seamless cloning capability.

  • Markerless gene manipulation: The pyrE gene (encoding orotate phosphoribosyltransferase) can be used as a counterselectable marker for markerless modifications .

When designing primers for cobS amplification, it's crucial to include appropriate restriction sites or overlap sequences for the chosen assembly method, while accounting for the high G+C content often found in thermophilic genes.

What assays are used to measure cobS activity?

Several assays can be employed to measure the activity of recombinant cobalamin synthase:

  • Spectrophotometric Assays:

    • Monitor changes in absorption spectra as the complete cobalamin molecule forms

    • Typically measured at wavelengths between 350-550 nm to detect corrinoid intermediates and products

  • HPLC Analysis:

    • Separation and quantification of cobalamin intermediates and final products

    • Allows detection of different cobamide forms based on their different lower ligands

  • Mass Spectrometry:

    • Precise identification of cobalamin products and intermediates

    • Can detect modifications and structural variations in the synthesized cobamides

  • Radioactive Assays:

    • Incorporation of radioactively labeled precursors (e.g., labeled 5,6-dimethylbenzimidazole)

    • Tracking the formation of complete radioactive cobalamin molecules

  • Functional Complementation:

    • Expression of recombinant cobS in cobS-deficient bacterial strains

    • Measurement of growth restoration in cobalamin-dependent conditions

The choice of assay depends on the specific research question, available equipment, and whether the focus is on enzyme kinetics, product characterization, or pathway integration.

How can researchers purify recombinant cobS while maintaining activity?

Purification of recombinant cobS from Thermoanaerobacter species requires special considerations to maintain the activity of this thermophilic enzyme:

  • Heat treatment: Exploit the thermostability of cobS by heating cell lysates to 55-65°C to precipitate many host proteins while keeping cobS in solution.

  • Anaerobic purification: Maintain anaerobic conditions throughout purification to prevent potential oxidative damage to the enzyme.

  • Metal-affinity chromatography: Use histidine tag purification with buffers containing stabilizing agents like glycerol (10-20%) and reducing agents to maintain enzyme integrity.

  • Size exclusion chromatography: Further purify the enzyme under anaerobic conditions to remove aggregates and obtain homogeneous protein.

  • Buffer optimization: Include cobalt ions in purification buffers to stabilize the active site, and maintain pH around 6.5-7.0 to mimic the optimal pH of Thermoanaerobacter species .

  • Rapid processing: Minimize the time between cell lysis and final purification steps to reduce potential for degradation.

  • Storage conditions: Store purified enzyme with glycerol (25-30%) at -80°C, or lyophilize with appropriate cryoprotectants to maintain long-term stability.

What experimental designs are most suitable for studying cobS function?

When designing experiments to study cobS function, researchers should consider the approaches recommended by COBS (Changing Ocean, Changing Ecosystems) for biological research:

  • Full factorial designs: These allow exploration of multiple factors affecting cobS activity simultaneously, including temperature, pH, metal cofactor concentration, and substrate availability .

  • Response surface methodology: This approach can identify optimal conditions for cobS activity by systematically varying multiple parameters and analyzing their interactions .

  • Gradient-based experiments: Creating gradients of stress conditions (such as temperature or pH) can help determine the functional limits and optimal range of cobS activity .

  • Time-course analyses: Monitor cobS activity over time to understand reaction kinetics, product formation rates, and enzyme stability under different conditions.

  • Comparative studies: Compare cobS from Thermoanaerobacter with homologs from other organisms to identify unique structural and functional features related to thermostability .

  • Mechanistic investigations: Use site-directed mutagenesis to identify key residues involved in catalysis, substrate binding, or thermostability.

These experimental approaches should be selected based on specific research questions and available resources, following the guidelines for rigorous experimental design in biochemical research .

How can isotopic labeling be used to study cobS-mediated reactions?

Isotopic labeling provides powerful tools for tracking cobS-mediated reactions and elucidating the mechanism of cobalamin synthesis:

  • 13C-labeled precursors: Using 13C-labeled aminolevulinic acid or other precursors allows tracking of carbon incorporation into the corrin ring structure.

  • 15N-labeled precursors: Employ 15N-labeled glutamine or other nitrogen sources to follow nitrogen incorporation into the cobalamin structure.

  • 57Co or 60Co labeling: Radioactive cobalt isotopes can trace cobalt incorporation and help quantify the efficiency of cobS-mediated cobalt insertion.

  • 2H (deuterium) labeling: Deuterated substrates can help identify specific hydrogen transfer steps in the reaction mechanism.

  • NMR spectroscopy applications: 13C and 15N-labeled cobS products can be analyzed using NMR to determine structural details and confirm correct product formation.

  • Mass spectrometry integration: Isotopically labeled products have characteristic mass shifts that can be detected by mass spectrometry, allowing precise tracking of reaction progress and identification of intermediates.

  • Pulse-chase experiments: These can determine the sequence of events in complex cobS-mediated reactions by adding labeled precursors at different time points.

By combining these isotopic labeling approaches with sensitive analytical techniques, researchers can elucidate the detailed mechanism of cobS function and identify any unique features of the Thermoanaerobacter enzyme.

How does cobS from Thermoanaerobacter sp. compare to cobS from mesophilic organisms?

The comparison between cobS from thermophilic Thermoanaerobacter and mesophilic organisms reveals important adaptations that contribute to thermostability:

FeatureThermoanaerobacter cobSMesophilic cobSSignificance
Amino acid compositionHigher proportion of charged residues (Arg, Glu)More hydrophobic residuesEnhanced ionic interactions stabilize structure at high temperatures
Secondary structureMore extensive α-helical regionsVariable secondary structureα-helices contribute to thermal stability
Disulfide bondsPotentially more disulfide bridgesFewer disulfide bondsCovalent cross-links enhance structural rigidity
Surface charge distributionMore uniform distribution of chargesLess uniform charge distributionPrevents aggregation at elevated temperatures
Cofactor binding sitesPotentially more rigid binding pocketsMore flexible binding regionsMaintains catalytic activity at high temperatures
Oligomeric statePotentially higher-order oligomersOften monomeric or dimericSubunit interactions can enhance stability

These structural differences likely contribute to the ability of Thermoanaerobacter cobS to maintain activity at elevated temperatures while preserving the catalytic mechanism essential for cobalamin synthesis.

Can recombinant cobS be engineered to improve cobalamin production?

Engineering recombinant cobS from Thermoanaerobacter for improved cobalamin production represents an advanced research direction with several promising approaches:

  • Directed evolution: Create libraries of cobS variants through random mutagenesis and screen for enhanced activity, stability, or substrate specificity.

  • Rational design: Target specific residues for mutation based on structural models or homology to enhance catalytic efficiency or thermostability.

  • Domain swapping: Exchange domains between cobS enzymes from different organisms to create chimeric enzymes with novel properties.

  • Co-expression optimization: Engineer expression systems that co-express cobS with other enzymes in the cobalamin biosynthesis pathway to create a more efficient production pipeline.

  • Protein fusion strategies: Create fusion proteins that bring cobS together with adjacent enzymes in the pathway to enhance substrate channeling and reaction efficiency.

  • Machine learning approaches: Apply computational methods to predict beneficial mutations based on large datasets of protein sequences and structures.

  • Metabolic engineering: Integrate optimized cobS into redesigned microbial strains with enhanced precursor production and reduced competing pathways.

Successful engineering efforts would need to balance enhanced activity with maintenance of the thermostability that makes Thermoanaerobacter cobS particularly valuable.

What is the relationship between cobS and cobamide remodeling enzymes?

The relationship between cobS and cobamide remodeling enzymes represents an interesting area of research in vitamin B12 metabolism:

Cobamide remodeling enzymes like CbiR and CbiZ enable bacteria to modify the structure of cobamides that they obtain from their environment . This process is particularly important because most organisms show selectivity for particular cobamide structures . The relationship between these remodeling enzymes and cobS involves several aspects:

  • Sequential pathway integration: While cobS is involved in de novo cobalamin synthesis, remodeling enzymes like CbiZ initiate the restructuring of existing cobamides by hydrolyzing specific bonds in the molecule .

  • Complementary functions: CbiZ can hydrolyze the amide bond adjacent to the aminopropanol linker in certain cobamides , while cobS is involved in the attachment of the upper axial ligand during synthesis.

  • Evolutionary significance: The presence of both synthesis (cobS) and remodeling enzymes suggests evolutionary adaptation to different environmental conditions and cobamide availability.

  • Regulatory connections: Expression of cobS and remodeling enzymes may be coordinately regulated based on the availability of exogenous cobamides and precursors.

  • Biotechnological applications: Understanding the interplay between these enzymes could lead to engineered systems capable of producing diverse cobamide structures with specific properties.

Research into this relationship could reveal important insights into how Thermoanaerobacter species manage their cobamide requirements in natural environments.

How do environmental factors influence cobS expression and activity?

Environmental factors significantly impact cobS expression and activity in Thermoanaerobacter species, reflecting their adaptation to specific ecological niches:

  • Temperature effects: While Thermoanaerobacter species can grow between 40-80°C, optimal enzyme activity likely occurs around 65-70°C . Temperature shifts may trigger stress responses that affect cobS expression.

  • Oxygen sensitivity: As strict anaerobes, Thermoanaerobacter species likely regulate cobS expression in response to even trace amounts of oxygen, potentially through redox-sensitive transcription factors.

  • Nutrient availability: Cobalt availability directly affects cobalamin synthesis, potentially regulating cobS expression through metal-responsive elements in its promoter region.

  • pH influence: Thermoanaerobacter species grow optimally at pH 6.3-6.8 , suggesting cobS activity may be highest in this range, with expression potentially regulated by pH-responsive transcription factors.

  • Carbon source effects: Different carbon sources influence the metabolic state of Thermoanaerobacter cells, potentially affecting cobS expression through central metabolic regulators. For instance, when grown on different substrates like cellobiose, glucose, or xylose, Thermoanaerobacter species produce different metabolite profiles , suggesting broader metabolic adjustments that might include cobamide synthesis.

  • Growth phase dependency: Gene expression for natural competence in Thermoanaerobacter kivui shows growth phase dependency , suggesting cobS expression might similarly vary across growth phases.

  • Stress response integration: Heat shock, nutrient limitation, or other stresses likely influence cobS expression as part of global stress response networks in these extremophilic bacteria.

Understanding these environmental influences is crucial for optimizing recombinant cobS production and activity in both research and potential biotechnological applications.

What are common challenges in working with recombinant cobS?

Working with recombinant cobS from Thermoanaerobacter presents several challenges that researchers should anticipate:

  • Protein misfolding: Expression in mesophilic hosts often leads to misfolding of thermophilic proteins at lower temperatures.

  • Inclusion body formation: High-level expression can result in insoluble protein aggregates, particularly in E. coli systems.

  • Incomplete cofactor incorporation: Insufficient cobalt availability during expression can lead to partially active enzyme.

  • Oxygen sensitivity: Exposure to oxygen during purification or storage can inactivate the enzyme.

  • Substrate availability: Limited availability of complex substrates required for activity assays.

  • Assay temperature requirements: Need for specialized equipment to conduct assays at elevated temperatures optimal for enzyme activity.

  • Enzyme stability during storage: Maintaining activity during long-term storage presents challenges.

  • Reproducibility issues: Variations in anaerobic conditions can lead to inconsistent results between experiments.

Addressing these challenges requires careful optimization of expression, purification, and assay conditions.

How can researchers optimize cobS expression levels in heterologous hosts?

To optimize expression of Thermoanaerobacter cobS in heterologous hosts, researchers should consider these strategies:

  • Codon optimization: Adjust the cobS coding sequence to match the codon bias of the expression host, which can significantly improve translation efficiency.

  • Induction conditions: Fine-tune inducer concentration, induction timing (typically mid-exponential phase is optimal) , and induction temperature to balance yield with proper folding.

  • Host strain selection: Test multiple expression strains, including those designed for expression of difficult proteins or those containing additional chaperones.

  • Promoter selection: Compare different promoters, such as T7 for E. coli or the gyrase promoter from Thermoanaerobacter sp. strain X514 (PgyrX514) for homologous expression .

  • Fusion partners: Evaluate various solubility-enhancing fusion tags (MBP, SUMO, thioredoxin) to improve folding and solubility.

  • Culture media optimization:

    • Add glycine betaine or proline as chemical chaperones

    • Supplement with cobalt salts to ensure cofactor availability

    • Adjust carbon source based on host metabolism

  • Growth conditions: Optimize temperature, pH, and aeration/anaerobic conditions to balance cell growth with proper protein folding.

  • Co-expression strategies: Co-express molecular chaperones from thermophilic organisms to assist proper folding of the recombinant cobS.

Systematic optimization using these approaches can significantly improve the yield and quality of recombinant cobS protein.

What approaches can resolve issues with inactive recombinant cobS protein?

When facing issues with inactive recombinant cobS, researchers can employ the following troubleshooting approaches:

  • Refolding protocols: If cobS forms inclusion bodies, develop a refolding protocol using gradual dialysis from denaturing conditions with controlled temperature ramps.

  • Chaperone-assisted folding: Co-express molecular chaperones, particularly those from thermophilic organisms, to assist proper folding during expression.

  • Metal incorporation: Ensure adequate cobalt availability by supplementing expression media with cobalt salts at appropriate concentrations.

  • Anaerobic expression: Implement strict anaerobic conditions during expression, possibly using specialized anaerobic expression systems.

  • Expression temperature adjustment: For thermophilic proteins, expressing at elevated temperatures (30-37°C) can sometimes improve folding compared to lower temperatures.

  • Fusion partner optimization: Test different fusion partners known to enhance solubility of difficult proteins, with cleavable linkers to remove the tag after purification.

  • Native purification conditions: Adjust purification buffers to mimic the natural cellular environment of Thermoanaerobacter, including appropriate pH (6.3-6.8) and salt concentrations.

  • Cofactor reconstitution: Develop protocols to reconstitute the enzyme with its cofactors post-purification under controlled conditions.

  • Protein engineering: Consider targeted mutations to enhance stability without compromising the active site, based on structural models or homology.

By systematically applying these approaches, researchers can often rescue activity in recombinant thermophilic enzymes like cobS.

How can researchers verify the authenticity and activity of purified recombinant cobS?

To verify that purified protein is indeed active Thermoanaerobacter cobS, researchers should employ multiple complementary techniques:

  • Mass spectrometry analysis:

    • Peptide mass fingerprinting to confirm protein identity

    • Intact mass analysis to verify complete polypeptide with expected modifications

  • Activity assays:

    • Spectrophotometric assays monitoring cobalamin formation

    • HPLC analysis of reaction products

    • Coupled enzyme assays that depend on cobalamin production

  • Structural verification:

    • Circular dichroism spectroscopy to confirm proper secondary structure

    • Thermal shift assays to verify expected thermostability

    • Limited proteolysis to assess proper folding

  • Functional complementation:

    • Restoration of growth in cobS-deficient bacterial strains

    • Rescue of cobalamin-dependent metabolic pathways

  • Binding studies:

    • Isothermal titration calorimetry to verify substrate binding

    • Fluorescence-based assays to monitor cofactor interactions

  • Immunological verification:

    • Western blotting using antibodies against cobS or epitope tags

    • Immunoprecipitation to verify interactions with known partners

  • In vivo validation:

    • Expression in a suitable host organism to confirm biological activity

    • Metabolomic analysis to detect increased cobalamin production

Using multiple methods provides robust confirmation of both protein identity and functional activity, ensuring reliable results in subsequent experiments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.