Recombinant Thermoanaerobacter sp. UPF0365 protein Teth514_1573 (Teth514_1573)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
floA; Teth514_1573; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-329
Protein Length
full length protein
Species
Thermoanaerobacter sp. (strain X514)
Target Names
Teth514_1573
Target Protein Sequence
MTEFIFLLVVIGLIFVFLSVILSFIPLGLWISALAAGVKIGIFTLVGMRLRRVPPDKIVK PLIKAIKAGQDVEINKLEAHYLAGGNVDKVIDALIAAQRANISLEFERAAAIDLAGRDVL HAVQMSVNPKVIETPVVAAVAKDGIEVKVKARVTVRANIDRLVGGAGEETIIARVGEGIV TTVGSSNSHKEVLENPDSISRTVLNKGLDAGTAFEILSIDIADVDVGRNIGARLQIDQAE ADKRIAQAKAEERRAMAVAREQEMKAMVQEMRAKVVEAEAEVPKAMAEALRTGKIGVMDY YNMRNVIADTMMRESFSKLGQERQQEEKE
Uniprot No.

Target Background

Function

Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are believed to play a significant role in regulating membrane fluidity.

Database Links
Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for maintaining Teth514_1573 stability?

Maintaining protein stability is crucial for reliable experimental outcomes. The recommended storage conditions for Teth514_1573 are:

ParameterRecommended ConditionNotes
Short-term storage4°CFor up to one week
Long-term storage-20°C to -80°CPreferred for extended storage
Buffer compositionTris-based buffer with 50% glycerolOptimized for protein stability
Alternative bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0Used in lyophilized formulations
Freeze-thaw cyclesMinimizeRepeated cycles reduce activity

For reconstitution of lyophilized protein, it is recommended to briefly centrifuge the vial before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol (final concentration) is advised before aliquoting for long-term storage . Working aliquots should be maintained at 4°C for up to one week to minimize degradation from repeated freeze-thaw cycles .

How is the protein typically expressed and what tags are commonly used?

Teth514_1573 is typically expressed in E. coli expression systems. The protein is commonly produced with an N-terminal His-tag to facilitate purification, though the specific tag type may vary depending on the production process and intended application . The expression region encompasses the full length of the protein (amino acids 1-329) .

Expression challenges may include those common to membrane-associated proteins, such as potential toxicity to host cells, inclusion body formation, or improper folding. Optimized expression protocols typically employ controlled induction conditions and specialized E. coli strains designed for expressing potentially challenging proteins .

What purification strategies yield the highest purity and activity of Teth514_1573?

Purification of Teth514_1573 typically employs affinity chromatography utilizing the His-tag, followed by additional purification steps to achieve high purity. A recommended purification protocol includes:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Intermediate purification: Size exclusion chromatography to separate full-length protein from truncated products

  • Polishing step: Ion exchange chromatography if higher purity is required

To distinguish full-length protein from truncated products, increasing the imidazole concentration during elution can be effective. For highest purity results (>90% as determined by SDS-PAGE), optimization of buffer conditions during each purification step is essential .

When dealing with potential membrane association properties of Teth514_1573, addition of mild detergents during cell lysis and initial purification steps may improve yield by preventing non-specific hydrophobic interactions .

What analytical methods are most effective for characterizing Teth514_1573?

Comprehensive characterization of Teth514_1573 requires multiple analytical approaches:

Analytical MethodApplicationExpected Results
SDS-PAGEPurity assessmentSingle band at approximately 35-37 kDa
Western blottingIdentity confirmationSpecific binding with anti-His antibody
Mass spectrometryAccurate mass determinationVerification of complete sequence
Circular dichroismSecondary structure analysisConfirmation of proper folding
Dynamic light scatteringAggregation assessmentMonodisperse population
Thermostability assaysFunctional characterizationStability profile at elevated temperatures

Given the thermophilic origin of this protein, thermal shift assays are particularly valuable for assessing functional integrity. Proper characterization should confirm that the recombinant protein maintains the expected thermal stability profile characteristic of proteins from Thermoanaerobacter species .

How can researchers effectively design interaction studies with Teth514_1573?

When designing protein-protein or protein-ligand interaction studies with Teth514_1573, researchers should consider:

  • Buffer optimization: Testing multiple buffer conditions is crucial as interactions may be salt or pH-dependent. A starting buffer of Tris-based solution (pH 7.5-8.5) with physiological salt concentration is recommended.

  • Binding assays: Surface Plasmon Resonance (SPR), Isothermal Titration Calorimetry (ITC), or pull-down assays utilizing the His-tag can be employed for interaction studies.

  • Temperature considerations: Given the thermophilic origin of the protein, interaction studies should be performed at both standard laboratory temperatures (25-30°C) and elevated temperatures (50-70°C) to assess temperature-dependent binding properties.

  • Control experiments: Include properly folded and denatured protein controls to distinguish specific from non-specific interactions.

  • Fluorescence-based approaches: Consider labeling strategies that maintain protein function for FRET or fluorescence polarization studies, particularly useful for kinetic analysis of interactions .

What functional roles has Teth514_1573 been implicated in within thermophilic systems?

While the detailed functional characterization of Teth514_1573 remains limited, several lines of evidence suggest potential roles:

  • Membrane organization and microdomain formation

  • Cellular signal transduction

  • Cytoskeletal interactions

  • Protein secretion and trafficking

The presence of hydrophobic regions in the N-terminal sequence supports a potential membrane association role. In thermophilic bacteria like Thermoanaerobacter, membrane proteins with flotillin-like properties may contribute to membrane stability under extreme temperature conditions, allowing for optimal cellular function in high-temperature environments .

Current research indicates that the protein may participate in membrane-associated protein complexes, though specific interacting partners have not been fully characterized in the available literature. Further functional studies utilizing gene knockout approaches and complementation assays would help elucidate its precise biological role.

How does the thermostability of Teth514_1573 compare to mesophilic homologs?

Comparative analysis between Teth514_1573 and mesophilic homologs reveals several adaptations typical of thermophilic proteins:

  • Amino acid composition: Higher proportion of charged residues (particularly Arg, Lys, Glu) that can form stabilizing salt bridges

  • Secondary structure elements: Potentially more compact packing of secondary structure elements with shorter loop regions

  • Disulfide bonding: Limited information is available on disulfide bond formation in Teth514_1573

  • Hydrophobic core: Likely contains an extensive hydrophobic core contributing to thermal stability

Experimental approaches to quantify thermostability differences include thermal denaturation experiments, differential scanning calorimetry, and activity assays performed across temperature gradients. These methods can establish the temperature optima and inactivation kinetics, providing insights into the molecular basis of thermostability .

What computational approaches can enhance structural and functional predictions for Teth514_1573?

Advanced computational methods provide valuable insights when experimental structural data is limited:

  • Homology modeling: While traditional homology modeling might be challenging due to limited structural information on UPF0365 family proteins, AI-based structure prediction tools like AlphaFold2 can generate reliable structural models.

  • Molecular dynamics simulations: These can reveal conformational flexibility and stability at different temperatures, particularly valuable for understanding thermostable proteins.

  • Protein-protein interaction prediction: Methods based on sequence conservation, co-evolution analysis, and machine learning can identify potential interaction partners.

  • Functional annotation transfer: Integrating genomic context analysis, phylogenetic profiling, and structural similarity searches can suggest functional roles.

  • Molecular docking: If flotillin-like function is confirmed, docking studies with membrane lipids and potential protein partners can elucidate interaction mechanisms.

These computational approaches should be validated with experimental studies to confirm predictions and generate new hypotheses for further investigation .

How can researchers address protein solubility and aggregation issues with Teth514_1573?

Solubility challenges with Teth514_1573 may arise from its potential membrane association properties. Recommended strategies include:

ChallengeSolution StrategyImplementation Notes
Inclusion body formationOptimization of expression conditionsLower induction temperature (16-20°C), reduced IPTG concentration
Low solubilityBuffer optimizationAddition of mild detergents (0.05-0.1% DDM or CHAPS)
Aggregation during storageStorage additive screeningAddition of arginine (50-100 mM) or trehalose (5-10%)
Precipitation during concentrationStep-wise concentrationGradual concentration with intermittent centrifugation to remove aggregates

For particularly challenging preparations, on-column refolding during purification might be necessary. This approach involves binding the denatured protein to the affinity resin, then gradually removing the denaturant through a decreasing gradient while the protein remains bound to the column .

What are the most effective strategies for validating the biological activity of Teth514_1573?

Validating biological activity requires a multi-faceted approach:

  • Structural integrity assessment: Circular dichroism spectroscopy to confirm proper secondary structure content compared to theoretical predictions.

  • Thermal stability assays: Differential scanning fluorimetry (DSF) to verify thermostability properties consistent with a protein from a thermophilic organism.

  • Membrane association studies: Liposome binding assays if flotillin-like function is suspected, potentially measuring membrane fluidity alterations in the presence of the protein.

  • Protein-protein interaction validation: Pull-down assays or crosslinking studies to identify interaction partners in Thermoanaerobacter lysates.

  • Functional complementation: Expression of Teth514_1573 in deletion mutants of related bacteria to assess functional conservation.

Activity validation should incorporate appropriate controls, including heat-denatured protein and, where possible, site-directed mutants affecting predicted functional residues .

How can researchers distinguish experimental artifacts from genuine findings when studying Teth514_1573?

Distinguishing artifacts from genuine findings requires rigorous experimental design:

  • Multiple detection methods: Employ orthogonal techniques to verify observations (e.g., combining SPR with ITC for interaction studies).

  • Comprehensive controls: Include tag-only controls, buffer-only controls, and non-specific protein controls in all experiments.

  • Concentration dependence: Test effects at multiple protein concentrations to establish dose-response relationships.

  • Independent preparation batches: Verify results with independently prepared protein batches to rule out preparation-specific artifacts.

  • Native vs. recombinant comparison: When possible, compare results between recombinant protein and native protein isolated from Thermoanaerobacter.

  • Statistical validation: Apply appropriate statistical tests and replicate experiments sufficiently to ensure reproducibility and significance .

What emerging applications might leverage the unique properties of Teth514_1573?

Several promising research directions for Teth514_1573 include:

  • Biocatalysis applications: If enzymatic activity is discovered, the thermostability of this protein could make it valuable for high-temperature industrial processes.

  • Membrane technology: Potential applications in developing thermostable membrane proteins for biosensors or separation technologies.

  • Protein engineering platform: Using Teth514_1573 as a scaffold for engineering thermostable fusion proteins or enzyme variants.

  • Structural biology insights: Contributing to the broader understanding of protein thermostability mechanisms through comparative structural studies.

  • Synthetic biology tools: Application in designing heat-resistant cellular systems or microbial cell factories operating at elevated temperatures.

The potential flotillin-like properties suggest applications in understanding and manipulating membrane organization under extreme conditions, which could have implications for both fundamental research and biotechnological applications .

What are the critical knowledge gaps in our understanding of Teth514_1573?

Several significant knowledge gaps remain to be addressed:

  • High-resolution structure: Crystal or cryo-EM structures would significantly advance understanding of this protein's function and thermostability mechanisms.

  • Physiological role: The specific biological function in Thermoanaerobacter remains incompletely characterized; gene knockout studies would be informative.

  • Interaction network: Comprehensive identification of protein and lipid interaction partners would clarify its cellular role.

  • Evolutionary conservation: Detailed phylogenetic analysis across thermophiles and comparison with mesophilic homologs could reveal adaptation patterns.

  • Post-translational modifications: Identification of any modifications in the native protein that might not be present in recombinant versions.

Addressing these gaps would require collaborative approaches combining structural biology, molecular biology, systems biology, and computational methods .

How might integration of multi-omics data enhance our understanding of Teth514_1573 function?

A comprehensive multi-omics approach could provide deeper insights:

  • Genomics: Comparative genomic analysis across thermophilic species to identify conserved genetic contexts and potential functional associations.

  • Transcriptomics: RNA-seq analysis under various growth conditions to determine expression patterns and potential co-regulation with other genes.

  • Proteomics: Interaction proteomics (IP-MS) to identify protein complexes containing Teth514_1573 in vivo.

  • Metabolomics: Changes in cellular metabolite profiles in knockout or overexpression strains to infer metabolic impacts.

  • Structural genomics: Integration of structural predictions with interaction data to develop mechanistic models of function.

Integration of these diverse data types using systems biology approaches and machine learning algorithms could reveal functional networks and generate testable hypotheses about the biological role of Teth514_1573 in thermophilic adaptation and cellular physiology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.