Recombinant Thermoanaerobacter tengcongensis Ribonuclease Y (rny)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customer use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rny; TTE1372; Ribonuclease Y; RNase Y
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-523
Protein Length
full length protein
Species
Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis)
Target Names
rny
Target Protein Sequence
MNHLLRRCRSISYVGLIITALIAILIGFLAGFLARKVIAESKIKSAENLARTILESAKKD AENKKREALLEAKEEIHRLRSDFEKEVRDRRGELQRLEKRLLQKEEILEKRAESLEQKEI LLEQKQKEIQQLEEQITLLHKKQLEELERISGLTQEEAKSILLESVQKEIQHDMAVMIKE MENKAKEEADRRAREIVGLAIQRCAADHAAETTVSVVTLPNDEMKGRIIGREGRNIRTIE TLTGIDLIIDDTPEAVVISGFDPIRREIARIALEKLIEDGRIHPARIEEMVEKAKKEVDN MIIKAGEEAAFEVGVHGLHPELIKLLGRLKFRTSYGQNVLKHSIEVAHLAGLMAYELGAD ASIAKRAGLLHDIGKAVDHEVEGPHVMIGAELAKRYHESDAVVHAIMAHHNDVEPQTIEA VLVQAADAISAARPGARREALEAYIKRLDKLEQIANSFEGVEKAYAIQAGREIRIMVKPE AISDDELVILARNISKKIEEEVEYPGQIKVTVIRETVAIDYAK
Uniprot No.

Target Background

Function
Endoribonuclease initiating mRNA decay.
Database Links

KEGG: tte:TTE1372

STRING: 273068.TTE1372

Protein Families
RNase Y family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Thermoanaerobacter tengcongensis and what ecological niche does it occupy?

T. tengcongensis is a rod-shaped, gram-negative (by empirical staining), anaerobic eubacterium isolated from a freshwater hot spring in Tengchong, China. This thermophile grows optimally at 75°C (range 50-80°C) and pH 7-7.5 (range 5.5-9), making it an extremophile adapted to high-temperature environments. The organism has a single circular chromosome of 2,689,445 bp with a relatively low genomic G+C content of 37.6%, typical of other Thermoanaerobacter genus members .

Despite being gram-negative by staining, genomic analysis reveals T. tengcongensis shares many genes characteristic of gram-positive bacteria while lacking molecular components unique to gram-negative bacteria, suggesting a unique evolutionary position . The organism metabolizes sugars as its principal energy and carbon source and utilizes thiosulfate and elemental sulfur, but not sulfate, as electron acceptors in its respiratory pathways .

How does Ribonuclease Y function in bacterial RNA metabolism?

Ribonuclease Y (rny) is a critical endoribonuclease involved in RNA processing and decay in bacteria. Unlike in eukaryotes where RNA degradation primarily begins with 3'-end poly(A) tail removal, bacterial RNA degradation often initiates with endonucleolytic cleavage, where enzymes like rny play essential roles. In the bacterial RNA degradation pathway, rny typically:

  • Recognizes specific RNA structures or sequences

  • Cleaves internal phosphodiester bonds in RNA molecules

  • Generates shorter RNA fragments with 5'-monophosphate and 3'-hydroxyl ends

  • Creates entry points for additional exoribonucleases to complete RNA degradation

As a thermophile, T. tengcongensis rny likely maintains this fundamental activity but with enhanced thermostability compared to mesophilic counterparts, similar to the thermostability observed in other T. tengcongensis proteins like its ribose binding protein (tteRBP) .

What genomic context surrounds the rny gene in T. tengcongensis?

The T. tengcongensis genome contains multiple transcriptional regulators, including over 50 activators and repressors involved in various physiological and metabolic pathways, as well as approximately 15 response regulators related to transcriptional regulation . The rny gene would likely be found in regulatory networks associated with RNA metabolism and processing.

T. tengcongensis has a distinctive genomic organization where 86.7% of its genes are encoded on the leading strand of DNA replication, which represents an unusual strand bias . This organization may influence the expression patterns of genes like rny, potentially affecting their regulation and function in RNA metabolism.

What expression systems are most suitable for recombinant production of T. tengcongensis Ribonuclease Y?

Based on successful expression of other T. tengcongensis proteins, the following expression system approach is recommended:

Expression System Selection:

  • E. coli BL21(DE3): Most commonly used for thermophilic protein expression due to its reduced protease activity and high expression levels

  • pET vector system: Particularly pET21a with C-terminal His-tag, which has proven successful for other T. tengcongensis proteins

Expression Protocol:

  • Clone the rny gene (minus any signal sequence) into pET21a with a C-terminal His-tag

  • Transform into E. coli BL21(DE3)

  • Culture in LB medium at 37°C until OD600 reaches 0.6-0.8

  • Induce with IPTG (0.5-1 mM) and continue growth for 4-6 hours

  • Harvest cells by centrifugation

This approach follows the successful expression strategy employed for the T. tengcongensis ribose binding protein, which yielded approximately 30 mg of pure protein per liter of medium .

What purification strategies are most effective for thermostable enzymes like T. tengcongensis Ribonuclease Y?

Two-step Purification Protocol:

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Lyse cells in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole

    • Apply to Ni-NTA column

    • Wash with increasing imidazole concentrations

    • Elute with 250 mM imidazole

  • Size Exclusion Chromatography:

    • Apply IMAC-purified protein to gel filtration column

    • Assess oligomeric state (monitor for potential aggregation)

    • Pool monomeric fractions for further analysis

Heat Treatment Advantage:
A unique benefit when working with thermophilic proteins is the option to include a heat treatment step (65-75°C for 15-20 minutes) during purification. This effectively denatures most E. coli host proteins while leaving the thermostable T. tengcongensis rny intact, significantly improving purity.

This purification strategy mirrors the successful approach used for tteRBP, which employed IMAC followed by gel filtration chromatography to obtain pure protein .

How can researchers determine the correct oligomeric state of purified T. tengcongensis Ribonuclease Y?

Determining the correct oligomeric state is crucial for functional studies. For T. tengcongensis proteins, researchers should employ multiple complementary techniques:

  • Size Exclusion Chromatography:

    • Monitor elution volume compared to molecular weight standards

    • Be alert for broad peaks that may indicate multiple oligomeric forms

    • For tteRBP, researchers observed a broad peak following the void volume, indicating potential oligomerization

  • Dynamic Light Scattering (DLS):

    • Measures hydrodynamic radius in solution

    • Useful for detecting concentration-dependent oligomerization

  • Native-PAGE:

    • Provides information about the native oligomeric state

    • Compare with SDS-PAGE to confirm differences between native and denatured states

  • Analytical Ultracentrifugation:

    • Gold standard for determining oligomeric state

    • Particularly sedimentation velocity experiments

For T. tengcongensis rny, careful fractionation of size exclusion chromatography peaks corresponding to calculated hydrodynamic radii consistent with the expected molecular weight would be recommended, following the approach used for tteRBP (which used fractions with a calculated hydrodynamic radius of 30 kDa ± 15 kDa) .

How does the amino acid composition of T. tengcongensis proteins contribute to their thermostability?

The exceptional thermostability of T. tengcongensis proteins (such as tteRBP with an apparent Tm of ~102°C compared to its E. coli homolog at ~56°C) can be attributed to specific amino acid substitution patterns . Based on structural studies of thermophilic proteins:

Key Thermostabilizing Features:

  • Core Region Substitutions:

    • Increased hydrophobic packing

    • Higher proportion of branched amino acids

    • Conservation of core residues across homologs

  • Boundary Region Adaptations:

    • Increased proline content in loops

    • Reduction in thermolabile residues (Asn, Gln, Cys, Met)

    • Strategic ion-pair networks

  • Surface Modifications:

    • Reduction in surface-exposed hydrophobic residues

    • Increased charged residue networks

    • Reduction in conformational entropy

What makes the tteRBP/ecRBP pair particularly interesting is that they maintain nearly identical backbone structures (0.41 Å RMSD of 235/271 Cα positions and 0.65 Å RMSD of 270/271 Cα positions) despite significant differences in thermal stability . This suggests that thermostability is primarily encoded by side-chain identity rather than backbone structural differences, a principle likely applicable to T. tengcongensis rny as well.

What assays are appropriate for measuring Ribonuclease Y activity at high temperatures?

Recommended High-Temperature Activity Assays:

  • Fluorescence-Based Assays:

    Assay TypeSubstrateTemperature RangeDetection MethodAdvantages
    FRET-basedDual-labeled RNA25-90°CFluorescenceReal-time monitoring
    Molecular BeaconSelf-quenched RNA25-90°CFluorescenceHigh sensitivity
  • Gel-Based Activity Assays:

    • Perform reactions at elevated temperatures (50-80°C)

    • Quench at different timepoints

    • Analyze RNA degradation products by denaturing PAGE

    • Quantify using phosphorimaging for radioactively labeled substrates

  • Circular Dichroism (CD) Monitoring:

    • Measure changes in RNA structure during degradation

    • Can be performed at elevated temperatures

    • Provides information about both activity and substrate structural changes

When designing these assays, buffer stability at high temperatures is critical. Use buffers with minimal temperature-dependent pH changes, such as phosphate buffers rather than Tris-based systems which have significant temperature-dependent pKa shifts.

How can structural comparisons between T. tengcongensis Ribonuclease Y and mesophilic homologs inform protein engineering?

The near-identical backbone structure but different thermal properties observed between tteRBP and ecRBP demonstrates that thermostability can be achieved without significant structural reorganization . This principle can guide protein engineering approaches:

Structure-Guided Engineering Approaches:

  • Homology Modeling:

    • Generate structural models of T. tengcongensis rny based on known structures

    • Identify regions with potential thermostabilizing substitutions

    • Classify substitutions as core, boundary, or surface locations

  • Chimeric Protein Design:

    • Create chimeras between thermophilic and mesophilic RNases

    • Test which regions contribute most significantly to thermostability

    • Develop minimally modified variants with enhanced stability

  • Rational Mutagenesis Strategy:

    RegionApproachExpected Outcome
    CoreConservative substitutionsMaintain function, enhance stability
    BoundaryProline introduction, glycine reductionReduce conformational entropy
    SurfaceIntroduce salt bridges, reduce hydrophobicityEnhance solubility and stability

These approaches leverage the observation that T. tengcongensis proteins achieve thermostability through specific amino acid substitutions while maintaining similar backbone structures to mesophilic homologs .

What computational methods are most effective for predicting thermostability in RNases?

Recommended Computational Approaches:

  • Molecular Dynamics (MD) Simulations:

    • Simulate protein behavior at different temperatures (25-100°C)

    • Monitor unfolding events and structural flexibility

    • Identify regions with high thermal motion

  • Energy Calculation Methods:

    • Calculate stabilization energies of different amino acid substitutions

    • Rosetta ΔΔG predictions for point mutations

    • FoldX or CUPSAT for stability change predictions

  • Machine Learning Approaches:

    • Train models on known thermostable/mesophilic protein pairs

    • Identify sequence patterns associated with thermostability

    • Predict stabilizing mutations for experimental validation

For T. tengcongensis rny specifically, these methods should incorporate knowledge from other characterized thermophilic proteins from the same organism, such as tteRBP, to leverage organism-specific adaptations to high temperatures .

How does RNA degradation differ in thermophilic bacteria compared to mesophiles?

RNA metabolism in thermophiles like T. tengcongensis faces unique challenges due to the high-temperature environment:

Key Differences in Thermophilic RNA Metabolism:

T. tengcongensis shows a strong correlation between the G+C content of tRNA and rRNA genes and its optimal growth temperature, a pattern observed in other thermophiles as well . This suggests specific adaptations in RNA metabolism to maintain functional RNA molecules at high temperatures.

What role might Ribonuclease Y play in the RNA degradosome of T. tengcongensis?

In many bacteria, RNases are organized into multi-enzyme complexes called degradosomes that coordinate RNA processing and degradation. For T. tengcongensis rny:

Potential Degradosome Organization:

  • Core Components:

    • Ribonuclease Y (rny) as a primary endoribonuclease

    • RNA helicase (potentially encoded by TTE1394 or TTE2299)

    • Phosphate acetyltransferase (TTE1482, TTE2195, or TTE2204)

    • Potentially other RNA processing enzymes

  • Functional Adaptations:

    • Thermostable protein-protein interactions

    • Specialized substrate channeling

    • Co-localization with transcription machinery

  • Regulatory Network:

    • Connection to stress response pathways

    • Integration with translation machinery

    • Potential interaction with the 12 two-component response regulators identified in T. tengcongensis

Understanding the composition and function of the T. tengcongensis RNA degradosome would provide insights into how thermophiles regulate RNA metabolism under extreme conditions.

How can T. tengcongensis Ribonuclease Y be utilized in RNA structural studies?

The thermostability of T. tengcongensis enzymes makes them valuable tools for RNA structural studies:

Research Applications:

  • Selective RNA Structure Probing:

    • Use at elevated temperatures to probe thermostable RNA structures

    • Perform time-controlled partial digestions

    • Map cleavage sites by primer extension or RNA-seq

  • RNA-Protein Interaction Studies:

    • Identify RNA regions protected from cleavage by bound proteins

    • Perform at various temperatures to study thermal stability of complexes

    • Compare patterns with mesophilic RNases

  • Methodology Advantages:

    ApplicationBenefit of Thermostable rnyTechnical Advantage
    RNA structure mappingActivity at high temperaturesProbing thermally stable structures
    Transcriptome analysisHigh specificityPotential novel cleavage patterns
    RNA purificationStability during preparationConsistent activity over time

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.