Recombinant Thermoanaerobacter thermosulfurogenes Probable starch degradation products transport system permease protein AmyC (amyC)

Shipped with Ice Packs
In Stock
Cat. No.
BT2147513
Source
in vitro E.coli expression system
Synonyms
amyC; Probable starch degradation products transport system permease protein AmyC
Quick Inquiry

Description

Biochemical Properties of the Transport System

The ABC transporter containing AmyC exhibits distinct kinetic parameters:

ParameterHigh-Affinity SystemLow-Affinity System
K<sub>m</sub>7 µM 400 µM
Energy couplingATP-dependent Proton gradient
Substrate specificityMaltose, maltotriose Broad specificity
InductionMaltose/starch Constitutive

The high-affinity system mediated by AmyC shows 57-fold greater substrate selectivity for maltose over other α-glucans . Biochemical assays using [14C]-maltose demonstrated complete energy dependence, with transport activity abolished by ATPase inhibitors .

Regulatory Mechanisms

Expression of amyC is tightly regulated through:

  • Carbon catabolite repression: Complete suppression during growth on glucose

  • Induction dynamics:

    • Maximum mRNA levels observed with maltose as substrate

    • 3.6-fold higher transcript abundance in starch vs. glucose media

  • Operon architecture:

    • Primary promoter upstream of amyB drives polycistronic amyBEDC transcription

    • Secondary promoter preceding amyE enables independent expression of transport components

Northern blot analyses revealed complex transcript processing, with stable mRNA secondary structures identified at intergenic regions .

Functional Integration with Starch Metabolism

AmyC operates in a coordinated system with extracellular hydrolytic enzymes:

  1. Pullulanase (AmyB): Generates maltotriose from starch

  2. α-Amylase (AmyA): Produces maltose via starch hydrolysis

  3. ABC transporter (AmyEDC): Imports hydrolysis products

This compartmentalized system enables:

  • Efficient carbon scavenging: 92% of extracellular maltose transported within 5 min at 60°C

  • Metabolic coupling: Transport rates correlate with amylase secretion (r = 0.89)

  • Thermostability: Maintains 78% activity after 4 hr at 65°C

Evolutionary and Biotechnological Significance

Comparative analysis reveals unique adaptations:

  • Thermophilic optimization: AmyC shows 34% sequence identity with E. coli MalF permease, but with increased hydrophobic residue content (42% vs. 38%)

  • Missing ATPase component: Unusually, the gene encoding the ATP-binding domain is not linked to amyEDC, suggesting either:

    • Remote chromosomal location

    • Shared usage with other transporters

  • Biocatalytic potential: The AmyC-containing system enables:

    • High-yield maltose production (up to 82 g/L from starch)

    • Thermostable bioreactor operation (≥60°C)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
amyC; Probable starch degradation products transport system permease protein AmyC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Thermoanaerobacterium thermosulfurigenes (Clostridium thermosulfurogenes)
Target Names
amyC
Target Protein Sequence
MRKVHVQKYLLTFLGIVLSLLWISPFYIILVNSFKTKLELFTNTLSLPKSLMLDNYKTAA ANLNLSEAFSNTLIITVFSILIIAIFSSMTAYALQRVKRKSSVIIYMIFTVAMLIPFQSV MIPLVAEFGKFHFLTRSGLVFMYLGFGSSLGVFLYYGALKGIPTSLDEAALIDGCSRFRI YWNIILPLLNPTTITLAVLDIMWIWNDYLLPSLVINKVGSRTLPLMIFYFFSQYTKQWNL GMAGLTIAILPVVIFYFLAQRKLVTAIIAGAVKQ
Uniprot No.
P37729

Target Background

Function
This protein is likely a component of a binding-protein-dependent transport system involved in starch degradation product metabolism. It is probably responsible for translocating the substrate across the membrane.
Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.