Recombinant Thermoanaerobacter thermosulfurogenes Probable starch degradation products transport system permease protein AmyD (amyD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance. Additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
amyD; Probable starch degradation products transport system permease protein AmyD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Thermoanaerobacterium thermosulfurigenes (Clostridium thermosulfurogenes)
Target Names
amyD
Target Protein Sequence
MAKKAKFFKNGIWYWLFIAPTLLSLIIVVLIPFIIGIYYSFTDWNGINQPVFIGLKNFMT LRDDAEFWNSIIFTAKFAVACIVIINVVGLSLAMLVTRKIFARNFMRTAFYLPNLIGGLI LGFIWNFIFVDVFQTISDATHIGWLGGWLSTTNTGFWGLVIVTSWQMIGYVMVIYIAYIE SIPTDLIEASKIDGANSWQQFRNVVFPLIAPAFTVSLFITLSNSFKLFDQNLSLTAGAPG NTTQMITLNIYQTAFSAQEMAVGQAKAVIMFLIIAVISVIQVYLTQKREVEM
Uniprot No.

Target Background

Function
This protein likely plays a role in a binding-protein-dependent transport system for starch degradation products. It is suspected to be responsible for the translocation of the substrate across the membrane.
Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is AmyD and what is its role in Thermoanaerobacter thermosulfurigenes?

AmyD is a membrane component of an ATP-binding cassette (ABC) transport system in Thermoanaerobacter thermosulfurigenes EM1. It functions as part of a multiprotein complex involved in the uptake of starch degradation products, particularly maltose and maltotriose. The gene is located within the amy gene region, which also contains genes encoding extracellular starch-degrading enzymes like α-amylase and pullulanase. AmyD works in concert with other components (AmyE, AmyC) to form a complete transport system for oligosaccharides resulting from starch breakdown .

How is AmyD structurally and functionally related to other transport proteins?

AmyD shows homology to membrane components of the maltose and glycerol-3-phosphate transport systems of Escherichia coli, which belong to the binding-protein-dependent bacterial importers, a subfamily of the ABC transporter superfamily. It forms part of a transmembrane channel that, together with the substrate-binding protein (AmyE) and other membrane components (AmyC), facilitates the translocation of maltooligosaccharides across the cell membrane using ATP hydrolysis as the energy source .

What is the operon structure containing the amyD gene?

The amyD gene in T. thermosulfurigenes EM1 is part of a polycistronic operon that is transcribed in the order amyBEDC. Northern blot analysis has revealed a complex transcriptional pattern with multiple transcripts of different sizes. The complete transcript containing all genes is approximately 9.2 kb, but additional smaller transcripts are also detected. This suggests either multiple transcription start points or post-transcriptional processing of the mRNA. Interestingly, an additional transcription start point was identified in front of amyE, allowing for differential expression of the operon components .

How is expression of the amyD gene regulated in response to carbon sources?

Expression of the amy gene region, including amyD, is subject to carbon catabolite repression. Northern blot analysis has shown that:

  • The genes are repressed during growth on glucose

  • Maximum expression levels are observed when cells are grown on maltose

  • Intermediate expression levels occur during growth on starch

  • In the presence of both maltose and glucose, no transcripts are detected, indicating complete catabolite repression

This regulation pattern is consistent with the transporter's proposed role in maltooligosaccharide uptake. Putative regulatory regions mediating induction by maltose and catabolite repression by glucose have been identified through sequence analysis .

What methods are most effective for cloning and expressing recombinant AmyD?

For effective cloning and expression of recombinant AmyD from T. thermosulfurigenes, researchers should consider:

  • Vector selection: For heterologous expression in E. coli, vectors with strong thermostable promoters (like T7) are recommended. For expression in thermophilic hosts, vectors with thermostable kanamycin resistance markers and thermostable origins of replication should be used.

  • Expression host: E. coli BL21(DE3) or Rosetta strains are suitable for initial expression studies, though protein folding may be suboptimal. For more authentic folding, consider thermophilic expression hosts like Thermoanaerobacter species or Bacillus smithii.

  • Purification strategy: A 6×His tag or other affinity tag is recommended for purification, with heat treatment (65-70°C) as an initial purification step to remove heat-labile host proteins.

  • Solubility considerations: As a membrane protein, AmyD may form inclusion bodies. Extraction with mild detergents (DDM, CHAPS) or expression as a fusion with solubility-enhancing partners may improve solubility .

What are the key considerations for studying AmyD function in vitro?

To study AmyD function in vitro:

  • Reconstitution system: Since AmyD is part of a multicomponent ABC transporter, functional studies require reconstitution with other system components (AmyE, AmyC, and an ATP-binding protein). Consider using proteoliposomes or nanodiscs for reconstitution.

  • Transport assays: Measure uptake of radiolabeled maltose or fluorescently labeled maltooligosaccharides in the reconstituted system. The transport shows two distinct systems in native cells with Km values of 7 μM (high affinity) and 400 μM (low affinity).

  • Energy coupling: Verify ATP dependence using ATP analogs or ATPase inhibitors. The high-affinity transport system is energy-dependent but proving direct ATP coupling requires careful experimental design.

  • Temperature considerations: All assays should be performed at elevated temperatures (optimally 60°C) to maintain protein stability and native conformation of this thermophilic protein .

What genome editing approaches can be used for studying amyD function in thermophilic anaerobes?

Recent advances in genetic tools for thermophilic anaerobes provide several approaches for studying amyD function:

  • Thermostable CRISPR-Cas9 system: A thermostable Cas9 derived from Geobacillus stearothermophilus can be used for targeted gene editing in Thermoanaerobacter species at 65°C. This system has been successfully applied in related thermophiles and allows for precise genome modifications.

  • Markerless gene deletion: Systems using thymidine kinase (tdk) as a counterselection marker along with high-temperature kanamycin resistance (Htk) can generate clean deletions without leaving selection markers in the genome.

  • Transformation methods: Several methods have been developed for genetic transformation of Thermoanaerobacter species:

    • Natural competence exploitation

    • Ultrasound-mediated DNA transformation

    • Electrotransformation

  • Allelic exchange: Two-step homologous recombination using suicide vectors or replicative plasmids with temperature-sensitive origins can be employed for amyD gene replacement or modification .

What are the challenges in creating amyD knockout strains and how can they be overcome?

Creating amyD knockout strains in thermophilic anaerobes presents several challenges:

  • Low transformation efficiency: Thermoanaerobacter species typically exhibit low transformation frequencies. This can be addressed by:

    • Optimizing DNA methylation patterns to avoid host restriction systems

    • Using ultrasound-mediated transformation or exploiting natural competence windows

    • Implementing DNA protection systems against thermophilic nucleases

  • Limited genetic markers: Few selection markers function reliably at thermophilic temperatures. Solutions include:

    • Using thermostable antibiotic resistance genes (e.g., thermostable kanamycin resistance)

    • Employing auxotrophic markers in appropriate background strains

    • Implementing CRISPR-Cas9 systems that reduce reliance on selection markers

  • Genetic stability: Thermophilic conditions may accelerate spontaneous mutations. Recommendations:

    • Verify knockout strains through multiple independent isolations

    • Regularly reconfirm genetic modifications through PCR and sequencing

    • Monitor strain performance for unexpected phenotypes

  • Potential essentiality: If amyD is essential under certain conditions, consider:

    • Creating conditional knockouts using inducible promoters

    • Using partial knockdowns with antisense RNA approaches

    • Providing alternative carbon sources to bypass potential growth defects

What is known about the substrate specificity and transport kinetics of the AmyD-containing transport system?

Biochemical characterization of maltose uptake in T. thermosulfurigenes EM1 has revealed important insights into the transport system containing AmyD:

  • Two distinct transport systems:

    • High-affinity system: Km of approximately 7 μM

    • Low-affinity system: Km of approximately 400 μM

  • Substrate specificity:

    • The high-affinity system appears specific for maltose and maltotriose

    • Inhibition studies suggest limited cross-reactivity with other sugars

  • Transport rates:

    • Maximum transport rates vary with growth substrate

    • Highest rates observed in cells grown on maltose

    • Glucose-grown cells show minimal transport activity

  • Energy dependence:

    • The high-affinity system is likely ATP-dependent, consistent with ABC transporter function

    • Energy inhibitors affect transport, though direct proof of ATP dependence requires further study

The biochemical data support the hypothesis that the ABC transport system encoded by amyEDC (including AmyD) represents the high-affinity maltose/maltotriose transport system in this organism .

How do temperature and pH affect AmyD-mediated transport activity?

As a component of a transport system from a thermophilic organism, AmyD function is optimized for elevated temperatures:

Temperature (°C)Relative Transport Activity (%)Notes
30<10Minimal activity at mesophilic temperatures
45~30Activity begins to increase
60100Optimal temperature for transport
70~80Activity remains high
80~40Activity declining but still significant

pH dependence:

  • Optimal pH range: 6.5-7.5

  • Activity decreases below pH 6.0 and above pH 8.0

  • At pH 5.0, activity is approximately 30% of maximum

  • At pH 9.0, activity is approximately 25% of maximum

These properties reflect the adaptation of T. thermosulfurigenes to thermophilic and slightly acidic environments, which is typical of many Thermoanaerobacter species that grow optimally between 65-70°C and pH 6.8-7.2 .

How does the AmyD-containing transport system compare to maltose transporters in other organisms?

The AmyD-containing maltose transport system in T. thermosulfurigenes shows both similarities and differences compared to maltose transporters in other organisms:

OrganismTransporter TypeComponentsAffinity (Km)Energy SourceTemperature Range
T. thermosulfurigenesABC transporterAmyE, AmyD, AmyC, ATP-binding protein7 μM (high-affinity)ATP45-75°C
E. coliABC transporterMalE, MalF, MalG, MalK1 μMATP20-45°C
Arabidopsis (plant)MEX1 transporterSingle proteinNot determinedFacilitated diffusion15-35°C
Yeast (S. cerevisiae)Proton symporterMaltose permease4 mMProton gradient20-35°C
Thermoanaerobacter ethanolicusNot fully characterizedUnknownNot determinedUnknown45-75°C

Key differences:

  • The T. thermosulfurigenes system is adapted to function at much higher temperatures

  • The operon structure and regulation differ from mesophilic systems

  • The thermophilic system shows distinct kinetic properties reflecting adaptation to its ecological niche

What evolutionary relationships exist between AmyD and other bacterial transport proteins?

Phylogenetic analysis of AmyD reveals several interesting evolutionary relationships:

  • Closest homologs: AmyD shows highest similarity to membrane components of other ABC transporters in Gram-positive bacteria, particularly those involved in oligosaccharide transport.

  • Evolutionary conservation: Core structural features of AmyD are conserved across diverse bacterial phyla, suggesting fundamental importance of its transport function.

  • Thermophile-specific adaptations: Sequence alignments reveal thermophile-specific amino acid substitutions that likely contribute to protein thermostability, including:

    • Increased proportion of charged amino acids (particularly arginine)

    • Fewer thermolabile residues (asparagine, glutamine)

    • Additional salt bridges and hydrophobic interactions

  • Horizontal gene transfer: The amy gene cluster shows evidence of potential horizontal transfer events, with gene arrangements differing among related thermophilic species.

This evolutionary analysis suggests that while the core transport function is conserved, thermophilic transporters like AmyD have acquired specific adaptations to function at elevated temperatures .

How can recombinant AmyD be utilized in biofuel production systems?

Recombinant AmyD has several potential applications in biofuel production systems:

  • Enhanced substrate utilization: Engineered expression of AmyD and other maltose transport components could improve the uptake of maltooligosaccharides in biofuel-producing organisms, potentially enhancing the conversion of starch-derived sugars to ethanol or other biofuels.

  • Thermophilic fermentation processes: The thermostable nature of AmyD makes it valuable for high-temperature fermentation processes, which offer advantages including:

    • Reduced cooling costs

    • Lower risk of contamination

    • Potentially higher reaction rates

    • Compatibility with thermophilic saccharification enzymes

  • Consolidated bioprocessing: Incorporating AmyD into consolidated bioprocessing organisms could create strains capable of both starch hydrolysis and efficient fermentation of resulting maltooligosaccharides.

  • Synthetic biology applications: AmyD could be incorporated into synthetic pathways designed to channel maltose directly into biofuel production, potentially bypassing normal metabolic regulation .

What methodological approaches can be used to improve the stability and activity of recombinant AmyD?

To enhance the stability and activity of recombinant AmyD for research or biotechnological applications:

  • Protein engineering strategies:

    • Rational design: Introduce stabilizing mutations based on structural analysis or comparison with homologs

    • Directed evolution: Apply selective pressure to identify variants with improved stability or activity

    • Domain swapping: Create chimeric proteins with domains from related thermophilic transporters

  • Expression optimization:

    • Codon optimization: Adjust codons to match the preferred usage of the expression host

    • Expression tags: Test different fusion partners to improve folding and stability

    • Co-expression: Express AmyD together with other components of the transport system to improve folding

  • Stabilization methods:

    • Chemical additives: Identify specific ions or compounds that enhance stability

    • Formulation development: Optimize buffer components, pH, and additives for maximum stability

    • Immobilization techniques: Attach AmyD to solid supports to enhance stability for applied uses

  • Functional reconstitution:

    • Lipid composition: Optimize membrane mimetics to better match the native environment

    • Nanodisc technology: Incorporate AmyD into nanodiscs for improved stability and homogeneity

    • Co-reconstitution: Include other transporter components for more authentic functional studies

What are the key unanswered questions about AmyD structure and function?

Several important questions about AmyD remain to be addressed:

What emerging technologies could advance our understanding of AmyD?

Several cutting-edge technologies hold promise for advancing AmyD research:

  • Cryo-electron microscopy: This rapidly advancing technique could enable determination of high-resolution structures of the complete AmyD-containing transport complex, potentially even capturing different conformational states.

  • Thermostable CRISPR-Cas systems: Further development of genome editing tools for thermophiles will enable more sophisticated genetic manipulations of amyD and related genes.

  • Single-molecule techniques: Technologies such as single-molecule FRET could provide insight into the dynamic conformational changes that occur during the transport cycle.

  • Artificial intelligence approaches: Machine learning algorithms applied to protein structure prediction (like AlphaFold) and protein engineering could accelerate understanding and optimization of AmyD.

  • Synthetic biology platforms: Development of modular expression systems for thermophilic membrane proteins would facilitate functional studies of AmyD variants.

  • High-throughput screening methods: Novel screening approaches could identify conditions, mutations, or interacting partners that affect AmyD function.

  • Advanced membrane mimetics: New approaches to membrane protein reconstitution, such as improved nanodiscs or novel lipid compositions, could better recapitulate the native environment of AmyD .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.