Recombinant Thermobaculum terrenum Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Thermobaculum terrenum SecD

SecD is a transmembrane protein subunit of the SecDF complex, which collaborates with the SecYEG channel and SecA ATPase to facilitate preprotein translocation across bacterial membranes. The recombinant form of T. terrenum SecD is expressed in E. coli for experimental applications, enabling biochemical and structural analyses .

Key Attributes:

  • Organism: Thermobaculum terrenum (thermophilic bacterium, optimal growth at 67°C) .

  • Function: Assists in post-translocational release of secretory proteins by coupling proton motive force (PMF) to substrate movement .

  • Complex Affiliation: Forms the SecDF complex with SecF, stabilizing the SecYEG channel during translocation .

Domain Architecture

  • Topology: SecD contains multiple transmembrane helices (TMS) and a large periplasmic domain .

  • Conserved Motifs: Includes regions critical for interaction with SecF and the PMF-driven conformational changes .

Mechanistic Role

  • PMF Utilization: SecD/SecF acts as a PMF-dependent chaperone, facilitating substrate release from the SecYEG channel .

  • Coordination with SecA: Enhances SecA ATPase activity and stabilizes membrane-inserted SecA during translocation .

Research Applications

Recombinant T. terrenum SecD is primarily used for:

  1. Mechanistic Studies: Investigating PMF-driven protein translocation in thermophiles .

  2. Structural Biology: Crystallization trials to resolve SecDF complex architecture .

  3. Antibiotic Development: Targeting bacterial secretion pathways .

Notable Challenges:

  • Thermostability: T. terrenum SecD’s thermophilic origin complicates purification but offers insights into high-temperature adaptations .

  • Heterologous Expression: Low yields in E. coli necessitate optimization .

Comparative Analysis with Homologs

FeatureT. terrenum SecDE. coli SecDM. jannaschii SecD
Thermal StabilityHigh (67°C optimum)Moderate (37°C)High (85°C optimum)
PMF DependencyYes Yes Presumed
Expression HostE. coli NativeArchaeal systems

Outstanding Research Questions

  1. How does T. terrenum SecD’s thermostability influence its interaction with SecF?

  2. What structural variations distinguish thermophilic SecD from mesophilic homologs?

  3. Can this recombinant protein inform the design of SecDF-targeted antimicrobials?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
secD; Tter_0079; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-515
Protein Length
full length protein
Species
Thermobaculum terrenum (strain ATCC BAA-798 / YNP1)
Target Names
secD
Target Protein Sequence
MRRSTLYSLIFIIILTAFAVWVDLPGSRNVFGRQAEVVEGLDLQGGLQVLLQARHVGGKA PTREQMEEVRQVVEQRVNSLGLTEPVVQLQGSDRIVVELPGVKDPEQAIRTFQGTGLLEF IDAGDTPLQVGTLVNTTLGPAITNGNQNQNSTKNGTPTPGTTPTPESTPQANQTPVAANV TPTPEDPQFQQALQATPPEQLQRTYTTVITGNDIANARPDFDPTTGEPVVSFELKPEAAK KFADFTTQNVGKYLAIALDKKIISSPQIRDPITNGRGVITGVTREEARTLAIQIRSGSLS VPLDIISSNTVGATLGNDSVQRSIRAGLIGIGAVALFMILYYRLPGFVSVVALAIYAAVV FALFKLIPVTLTLAGIAGFILSVGMAVDANVLIFARLKDELRRGRGLIQAIDVGFKNAWP SIRDSNISTLITCAILIWFGSRFGASVIKGFAITLAIGVIVSMFTAIFVTRTLLQVVLSM VHTRNLWIWGIGKNQLPEPEGRTLQPAKSSRTTQA
Uniprot No.

Target Background

Function
This protein is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Thermobaculum terrenum and why is it significant in microbiological research?

Thermobaculum terrenum is a thermophilic soil bacterium that grows optimally at 65°C. The strain YNP1 (ATCC BAA-798) has garnered significant scientific interest due to its unique biochemical properties. T. terrenum is notable for being the first bacterium discovered to possess a functional O-GlcNAc system, previously thought to be exclusive to metazoan organisms . This bacterium exhibits an expanded substrate specificity in various enzymatic reactions, including its transaminase activity with L-amino acids and (R)-(+)-1-phenylethylamine using α-ketoglutarate and pyruvate as amino acceptors . These distinctive characteristics make T. terrenum an exceptional model organism for studying protein modifications, enzyme evolution, and thermophilic adaptations. Understanding this organism provides insights into evolutionary biology and potentially novel protein engineering approaches for thermostable enzymes.

What is the function of Protein translocase subunit SecD in bacterial systems?

Protein translocase subunit SecD functions as an integral component of the bacterial Sec protein translocation pathway, which is responsible for transporting proteins across the cytoplasmic membrane. The amino acid sequence provided for T. terrenum SecD indicates it contains multiple transmembrane domains characteristic of membrane proteins involved in transport functions . In bacterial systems, SecD typically works in conjunction with SecF to form a complex (SecDF) that enhances protein translocation efficiency through several mechanisms:

  • ATP-independent enhancement of protein translocation kinetics

  • Release of translocated proteins from the Sec machinery

  • Maintenance of the proton motive force necessary for efficient protein transport

  • Prevention of backsliding of partially translocated proteins

The protein plays a critical role in the later stages of protein translocation, ensuring that secreted proteins reach their final destination outside the cytoplasmic membrane or are properly integrated into the membrane.

What are the optimal laboratory conditions for cultivating Thermobaculum terrenum?

The successful cultivation of T. terrenum requires specific conditions that accommodate its thermophilic nature. Based on established protocols, the optimal growth conditions include:

ParameterConditionNotes
Temperature65°CCritical for optimal growth
MediumNYZ broth10g casamino acids, 5g yeast extract, 5g NaCl/liter
Solidifying agent0.8% Gelzan CM GelriteFor plate cultures
Supplementation0.2% glucoseFor liquid cultures
AgitationVigorousRequired for optimal aeration
Initial culture time5 daysFor plate cultures from glycerol stocks
Starter culture time2 daysFor liquid cultures

The cultivation process typically begins by streaking cells from a glycerol stock onto an NYZ plate and incubating at 65°C for 5 days. A single colony is then inoculated into 5 ml of NYZ broth supplemented with 0.2% glucose, and this starter culture is incubated at 65°C for 2 days with vigorous agitation before being used to inoculate experimental cultures . These precise conditions are essential for successful growth and subsequent research applications.

What strategies can optimize the expression and purification of recombinant T. terrenum SecD protein?

The expression and purification of T. terrenum SecD presents several challenges due to its membrane protein nature and thermophilic origin. Based on successful approaches with other T. terrenum proteins, the following optimized strategy is recommended:

Expression optimization:

  • Vector selection: pGEX-6P-1 vector has been successfully used for T. terrenum proteins . This provides a GST fusion tag that can enhance solubility and facilitate purification.

  • Host strain selection: E. coli strains specialized for membrane proteins (C41(DE3), C43(DE3)) may improve expression yields.

  • Expression conditions:

    • Induction at OD600 0.6-0.8

    • Lower induction temperature (16-25°C) to facilitate proper folding

    • Reduced IPTG concentration (0.1-0.5 mM)

    • Extended expression time (16-20 hours)

Purification strategy:

  • Cell lysis: Gentle lysis methods using mild detergents to solubilize membrane proteins

  • Membrane extraction: Two-phase extraction with carefully selected detergents (DDM, LDAO, or Fos-Choline)

  • Affinity chromatography: Glutathione-based purification for GST-tagged protein

  • Tag cleavage: On-column cleavage with PreScission protease

  • Secondary purification: Size exclusion chromatography for final purity

Storage conditions:

The commercially available T. terrenum SecD is stored in Tris-based buffer with 50% glycerol at -20°C, with recommendations for extended storage at -80°C . Working aliquots can be maintained at 4°C for up to one week, with repeated freeze-thaw cycles strongly discouraged to maintain protein integrity.

How can researchers evaluate the structural and functional properties of T. terrenum SecD?

Comprehensive characterization of T. terrenum SecD requires a multi-faceted approach combining structural, biochemical, and functional analyses:

Structural characterization:

  • Bioinformatic analysis: Sequence alignment with well-characterized SecD proteins from other species can identify conserved domains and unique features. The full-length sequence available for T. terrenum SecD provides a starting point for these analyses.

  • Secondary structure prediction: Prediction of transmembrane segments, α-helices, β-sheets, and disordered regions

  • Tertiary structure determination approaches:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy (particularly suitable for membrane proteins)

    • NMR spectroscopy for domain-specific structural information

  • Thermostability assessment: Differential scanning calorimetry or circular dichroism spectroscopy at various temperatures to assess thermal stability

Functional characterization:

  • ATPase activity assays: Measuring ATP hydrolysis rates under various conditions

  • Protein translocation assays: In vitro reconstitution of the Sec system with purified components

  • Proton translocation measurements: Assessment of proton-motive force utilization

  • Protein-protein interaction studies: Pull-down assays, crosslinking experiments, or surface plasmon resonance to identify interaction partners

These approaches should be conducted at temperatures relevant to T. terrenum's natural growth conditions (around 65°C) to ensure physiological relevance of the findings.

What methodological approaches can investigate the interactions between T. terrenum SecD and other Sec pathway components?

Understanding the interaction network of SecD within the T. terrenum Sec translocation system requires sophisticated methodological approaches:

Genetic approaches:

  • Co-expression studies of SecD with other Sec components in heterologous systems

  • Bacterial two-hybrid or split-GFP complementation assays to detect protein-protein interactions

  • Suppressor mutation analysis to identify functional relationships between components

Biochemical approaches:

  • Co-immunoprecipitation with antibodies against SecD or epitope-tagged versions

  • Pull-down assays using immobilized SecD to capture interaction partners

  • Crosslinking studies with various crosslinking agents to capture both stable and transient interactions

  • Surface plasmon resonance or isothermal titration calorimetry for quantitative binding parameters

Structural approaches:

  • Cryo-electron microscopy of the assembled Sec complex

  • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • FRET-based assays using fluorescently labeled Sec components to monitor interactions in real-time

In silico approaches:

  • Molecular docking simulations to predict interaction interfaces

  • Molecular dynamics simulations to assess the stability of predicted complexes

  • Coevolutionary analysis to identify co-varying residues between SecD and other Sec components

Through the integration of these complementary approaches, researchers can build a comprehensive model of how SecD functions within the broader context of the T. terrenum protein secretion machinery.

How does T. terrenum SecD compare with homologous proteins from mesophilic bacteria?

The comparative analysis of SecD from thermophilic T. terrenum versus mesophilic bacteria provides insights into both conserved functional features and thermoadaptive modifications:

Sequence-level adaptations:

  • Increased proportion of charged residues (particularly arginine) for enhanced ionic interactions

  • Higher percentage of hydrophobic amino acids in the protein core

  • Reduction in thermolabile residues (asparagine, glutamine, cysteine)

  • Shorter loop regions to reduce conformational flexibility

Functional considerations:

A comprehensive comparison would involve homology modeling based on available structural data from other bacterial SecD proteins, followed by molecular dynamics simulations at different temperatures to assess structural stability and conformational changes relevant to function.

What experimental design would effectively investigate the role of specific residues in T. terrenum SecD function?

A systematic structure-function analysis of T. terrenum SecD requires a well-designed mutagenesis approach:

Residue selection strategy:

  • Identify conserved residues through multiple sequence alignment with SecD proteins from diverse bacteria

  • Target residues in predicted functional domains (ATP-binding, membrane interaction, protein-protein interaction sites)

  • Select thermostability-associated residues unique to thermophilic SecD homologs

  • Design a panel of mutations representing:

    • Conservative substitutions (maintaining chemical properties)

    • Non-conservative substitutions (altering chemical properties)

    • Alanine-scanning of functional domains

Methodological workflow:

  • Site-directed mutagenesis using PCR-based techniques similar to those described for other T. terrenum proteins

  • Expression and purification of mutant proteins using optimized protocols

  • Biophysical characterization:

    • Thermal stability analysis (DSC, CD spectroscopy)

    • Secondary structure assessment (CD spectroscopy)

    • Tertiary structure analysis (limited proteolysis, intrinsic fluorescence)

  • Functional characterization:

    • ATPase activity assays

    • Protein translocation efficiency measurements

    • Proton gradient utilization assessment

Data analysis approach:

  • Correlation of structural changes with functional alterations

  • Classification of residues as essential, important, or dispensable

  • Mapping of functional residues onto structural models

  • Comparison with equivalent residues in mesophilic SecD proteins

This systematic approach would generate a comprehensive residue-level understanding of structure-function relationships in T. terrenum SecD, potentially revealing unique adaptations for thermostability and function.

How can T. terrenum SecD be utilized for studying protein translocation in extremophiles?

T. terrenum SecD offers a unique model system for investigating protein translocation under extreme conditions:

  • Reconstituted in vitro systems: Purified T. terrenum SecD can be incorporated into liposomes along with other Sec components to create a minimal translocation system functional at high temperatures. This system would allow the investigation of:

    • Temperature-dependent translocation efficiency

    • Substrate specificity under extreme conditions

    • Energetic requirements for thermostable protein translocation

  • Comparative systems biology: The T. terrenum Sec system can serve as a reference point for comparing translocation mechanisms across extremophiles, including:

    • Psychrophilic (cold-loving) organisms

    • Halophilic (salt-loving) organisms

    • Acidophilic or alkaliphilic organisms

  • Evolutionary studies: Analysis of the T. terrenum SecD in the context of other extremophilic SecD proteins can provide insights into:

    • Convergent evolution in protein translocation systems

    • Essential versus adaptive features for functioning in extreme environments

    • Evolutionary trajectory of the Sec system across diverse ecological niches

  • Biotechnological applications: Understanding the thermostable nature of T. terrenum SecD could inform the design of robust protein secretion systems for industrial applications requiring:

    • High-temperature bioprocessing

    • Enhanced stability in harsh industrial conditions

    • Improved protein secretion efficiency for biomanufacturing

What insights from O-GlcNAc systems in T. terrenum might be relevant to SecD function?

T. terrenum possesses a functional O-GlcNAc system that was previously thought to be exclusive to metazoa . This unique feature may have implications for SecD function and protein translocation:

  • Potential regulatory mechanisms: The O-GlcNAc transferase (OGT) and O-GlcNAcase (OGA) in T. terrenum are co-expressed and localize to the cytoplasm , suggesting potential regulatory roles for protein function. SecD could potentially be subject to O-GlcNAcylation as a regulatory mechanism affecting:

    • Protein stability and half-life

    • Interaction with other Sec components

    • Conformational changes during the translocation cycle

  • Experimental approaches to investigate potential O-GlcNAcylation of SecD:

    • Mass spectrometry analysis of purified SecD for O-GlcNAc modifications

    • Western blotting with O-GlcNAc-specific antibodies

    • Site-directed mutagenesis of predicted O-GlcNAcylation sites

  • Functional implications: If SecD is found to be O-GlcNAcylated, functional studies could explore:

    • The effect of OGT inhibitors (such as Ac4-5S-GlcNAc, which inhibits T. terrenum growth ) on SecD function

    • Correlation between cellular stress, O-GlcNAcylation levels, and protein translocation efficiency

    • Potential crosstalk between O-GlcNAcylation and other post-translational modifications

The discovery of bacterial O-GlcNAcylation in T. terrenum opens new avenues for understanding how this modification might regulate fundamental cellular processes including protein translocation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.