Recombinant Thermobaculum terrenum Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant T. terrenum SecF

SecF is a core component of the SecDF complex, which works alongside SecYEG and SecA to translocate nascent polypeptides across bacterial membranes. The recombinant variant of T. terrenum SecF (UniProt ID: D1CDJ6) is expressed in E. coli with an N-terminal His tag, enabling purification via affinity chromatography . Key features include:

PropertyDetail
SpeciesThermobaculum terrenum (strain ATCC BAA-798/YNP1)
Gene NamesecF (locus: Tter_0080)
Protein LengthFull-length (1–317 amino acids)
Molecular Weight~37 kDa (calculated)
Expression SystemEscherichia coli
TagN-terminal His tag
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder at -20°C/-80°C in Tris/PBS buffer with 6% trehalose

Recombinant Expression

  • Cloning: The secF gene (GenBank: YP_003321824.1) is codon-optimized for E. coli expression .

  • Purification: Nickel-affinity chromatography followed by gel filtration .

  • Yield: ~1.0 mg/L culture under optimized conditions .

Research Applications

  • Structural Biology: Crystallography and AFM to study SecDF-SecYEG interactions .

  • Functional Assays: Reconstitution into proteoliposomes to measure translocation efficiency .

  • Thermostability Studies: T. terrenum SecF’s heat resistance (optimal growth at 67°C ) aids in probing thermophilic adaptation .

Comparative Analysis with Homologs

T. terrenum SecF shares homology with:

  • Mycobacterium leprae SecF*: Longer sequence (1–471 aa) but similar TM topology .

  • Escherichia coli SecF*: 84% structural similarity in the periplasmic domain .

FeatureT. terrenum SecFE. coli SecF
Length (aa)317328
ThermostabilityHigh (>70°C)Moderate (~37°C)
PMF UtilizationEnhancedModerate

Research Findings

  • Interaction with SecYEG: Co-assembly with SecYEG increases SecDF’s intermediate (I) conformation population ninefold, enhancing translocation efficiency .

  • Role in Holotranslocon: SecDF stabilizes SecYEG and collaborates with YidC for membrane protein insertion .

  • Mutational Studies: Deletion of the P1 domain abolishes PMF-driven translocation .

Future Directions

  • Drug Development: Targeting SecDF’s proton channel could disrupt bacterial secretion pathways .

  • Biotechnological Engineering: Thermostable SecF variants may improve industrial protein secretion systems .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate specific requirements for the format. Please indicate your preference when placing your order, and we will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of that specified tag.
Synonyms
secF; Tter_0080; Protein translocase subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Thermobaculum terrenum (strain ATCC BAA-798 / YNP1)
Target Names
secF
Target Protein Sequence
MIDIVRWRYAFYLLSLLIIIPGTIYLLLFGLRLGIDFEGGTFWQIQFEKPVRIEDVRSAL AQAGYNEAFVQSFGQQSNTAQGTVTRGVSMRLPEIKENSPEKAKLEQILKSRFGNYEELV FTSVGPAVGREIRNRSIVAIALASLGILGYIAFAFRKVSHPFRYGICAIIAMLHDVLVVV GIFAILGKHFGVEIDALFVTALLTVIGFSVHDTIVVFDRIRENQLRRYGESFEQIVNISL LQTLVRSVNTSMTVIFTLLALYFFGGTTIKHFVLALLIGIVSGTYSSIFNASLLLVSWEN KDFLRIFRRTEPEAAAT
Uniprot No.

Target Background

Function
SecF is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Thermobaculum terrenum and why is its SecF protein of research interest?

Thermobaculum terrenum is a thermophilic bacterium originally isolated from a geothermally heated soil in Yellowstone National Park with temperatures ranging from 65-92°C and an acidic pH of 3.9. This organism is particularly significant as it belongs to the evolutionarily interesting phylum Chloroflexi, which has been proposed to represent some of the earliest life forms on Earth .

The SecF protein from T. terrenum is a component of the bacterial Sec translocase system, which facilitates protein translocation across the cytoplasmic membrane. This protein is of research interest due to its thermostable properties, which could provide insights into protein folding and stability under extreme conditions. The study of SecF from thermophilic organisms may contribute to our understanding of membrane protein biogenesis in extremophiles and potentially lead to biotechnological applications requiring thermostable components.

How does the Sec translocase system function in bacteria, and what specific role does SecF play?

The Sec translocase system in bacteria is responsible for the transport of proteins across the cytoplasmic membrane, either for secretion into the periplasm/extracellular environment or for insertion into the membrane. The core components include SecY, SecE, and SecG, which form the channel, and SecA, which acts as an ATPase to provide energy for translocation.

SecF functions as part of the SecDF complex, which associates with the SecYEG channel. This complex enhances protein translocation efficiency and is particularly important for post-translocation steps. SecF is believed to be involved in:

  • Facilitating the final stages of protein translocation

  • Preventing backsliding of partially translocated proteins

  • Contributing to the release of translocated proteins from the Sec machinery

  • Possibly coupling proton motive force to protein translocation

In thermophilic organisms like T. terrenum, SecF would need to maintain these functions under high-temperature conditions, suggesting adaptations in its structure that contribute to thermostability while preserving function.

What expression systems are most effective for producing recombinant T. terrenum SecF protein?

For the expression of recombinant T. terrenum SecF protein, E. coli-based expression systems have proven effective according to available research data . The expression system typically involves:

  • Cloning the secF gene into appropriate expression vectors (such as pET series)

  • Transformation into E. coli expression strains (commonly BL-21 or derivatives)

  • Induction of protein expression using IPTG (typically at concentrations around 0.1-1.0 mM)

  • Expression at lower temperatures (16-30°C) to improve proper folding of membrane proteins

For membrane proteins like SecF, specialized strategies may include:

  • Using E. coli C41(DE3) or C43(DE3) strains that are adapted for toxic/membrane protein expression

  • Incorporation of fusion tags such as superfolder GFP to monitor expression and folding

  • Co-expression with chaperones to improve folding and stability

  • Employing specialized media formulations to support membrane protein production

When expressing thermostable proteins from thermophiles, the E. coli host cells are typically grown at their optimal temperature (37°C), rather than at the native temperature of T. terrenum (65-67°C), as the expression host cannot survive such high temperatures .

What are the optimal purification methods for recombinant T. terrenum SecF protein?

Purification of recombinant T. terrenum SecF protein typically follows a multi-step process optimized for membrane proteins:

  • Cell Lysis: Sonication in appropriate buffer systems containing:

    • 50 mM NaH₂PO₄

    • 300 mM NaCl

    • 5 mM imidazole

    • pH 8.0

  • Membrane Extraction:

    • Preparation of membrane fractions by ultracentrifugation

    • Solubilization using detergents (commonly n-dodecyl-β-D-maltoside (DDM), Triton X-100, or CHAPS at 0.5-2%)

  • Affinity Chromatography:

    • Ni-NTA agarose resin for His-tagged proteins

    • Washing with buffer containing low imidazole concentrations (20-40 mM)

    • Elution with higher imidazole concentrations (250-500 mM)

  • Further Purification (if needed):

    • Size exclusion chromatography to remove aggregates and achieve higher purity

    • Ion exchange chromatography for additional purification

  • Quality Assessment:

    • SDS-PAGE for purity evaluation (typically >90% purity)

    • Western blotting for confirmation of identity

    • Mass spectrometry for precise molecular weight determination

Throughout the purification process, it is essential to maintain the presence of detergents at concentrations above their critical micelle concentration to keep membrane proteins solubilized.

How should researchers store and handle purified T. terrenum SecF protein to maintain its stability?

For optimal storage and handling of purified T. terrenum SecF protein, the following guidelines should be followed:

  • Short-term Storage:

    • Store working aliquots at 4°C for up to one week

    • Maintain in buffer containing appropriate detergent concentrations

  • Long-term Storage:

    • Store at -20°C or preferably -80°C

    • Aliquot to avoid repeated freeze-thaw cycles

    • Add glycerol (final concentration 6-50%) as a cryoprotectant

  • Reconstitution from Lyophilized Form:

    • Briefly centrifuge the vial before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol (recommended final concentration 50%) for long-term storage

  • Handling Precautions:

    • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

    • When thawing, keep the protein on ice to prevent degradation

    • Work quickly and maintain cold temperatures during experimental procedures

    • Supplement buffers with protease inhibitors when appropriate

The thermostable nature of proteins from T. terrenum may provide greater handling flexibility compared to mesophilic proteins, but proper storage conditions remain essential for maintaining structural integrity and function.

How can researchers utilize T. terrenum SecF protein as a model for studying thermostable membrane proteins?

T. terrenum SecF protein offers several advantages as a model system for studying thermostable membrane proteins:

  • Thermostability Studies:

    • Compare structural features with mesophilic homologs to identify thermostabilizing elements

    • Perform thermal unfolding experiments to determine melting temperatures and stability parameters

    • Investigate the role of specific amino acid compositions and distributions in conferring thermostability

  • Membrane Protein Folding Research:

    • Study folding pathways under various temperature conditions

    • Examine how thermophilic membrane proteins achieve proper insertion and folding

    • Compare with mesophilic counterparts to identify critical differences in folding dynamics

  • Structure-Function Relationships:

    • Generate site-directed mutants to identify residues critical for thermostability

    • Correlate structural features with functional properties at different temperatures

    • Develop predictive models for engineering thermostable membrane proteins

  • Protein Engineering Applications:

    • Use as a scaffold for engineering novel thermostable membrane proteins

    • Transfer thermostabilizing features to less stable homologs

    • Create chimeric proteins to understand domain-specific contributions to stability

Similar approaches have been successfully applied to other thermostable proteins from T. terrenum, such as the Laccase-like multi-copper oxidases (LMCOs), which demonstrated remarkable thermostability and have been well-characterized .

What biophysical techniques are most informative for characterizing T. terrenum SecF structure and function?

Several biophysical techniques can provide valuable insights into the structure and function of T. terrenum SecF:

  • Spectroscopic Methods:

    • Circular Dichroism (CD) spectroscopy to assess secondary structure content and thermal stability

    • Fluorescence spectroscopy to monitor conformational changes and ligand binding

    • Fourier Transform Infrared (FTIR) spectroscopy for detailed secondary structure analysis in membrane environments

  • Advanced Structural Techniques:

    • X-ray crystallography (challenging for membrane proteins but potentially informative)

    • Cryo-electron microscopy for structural determination without crystallization

    • Nuclear Magnetic Resonance (NMR) spectroscopy for dynamic structural information

    • Small-angle X-ray scattering (SAXS) for low-resolution structural information in solution

  • Functional Assays:

    • Reconstitution into proteoliposomes to assess transport activity

    • ATPase assays to measure coupling with SecA

    • Protein translocation assays using fluorescently labeled substrates

    • Proton transport measurements to assess proton motive force coupling

  • Thermal Stability Analysis:

    • Differential scanning calorimetry (DSC) to determine precise thermodynamic parameters

    • Thermal shift assays to assess stabilizing conditions and ligand effects

    • Activity assays at varying temperatures to establish functional stability profiles

  • Computational Methods:

    • Molecular dynamics simulations to understand behavior in membrane environments

    • Sequence and structure analysis to identify conserved features and unique adaptations

For membrane proteins like SecF, selecting appropriate detergents or lipid environments is crucial for obtaining physiologically relevant results in these biophysical studies.

What considerations are important when designing experiments to study protein translocation using T. terrenum SecF?

When designing experiments to study protein translocation using T. terrenum SecF, researchers should consider several important factors:

  • Temperature Conditions:

    • Design experiments that account for the thermophilic nature of T. terrenum (optimal growth at 67°C)

    • Include appropriate temperature controls (both physiological temperature for T. terrenum and standard temperatures for comparison)

    • Ensure equipment and reagents can withstand experimental temperatures

  • Reconstitution Systems:

    • Select appropriate lipid compositions that maintain fluidity at higher temperatures

    • Consider incorporating other components of the Sec system (SecY, SecE, SecD) from T. terrenum or compatible thermophiles

    • Optimize protein-to-lipid ratios for functional reconstitution

  • Substrate Selection:

    • Use native T. terrenum secretory proteins as translocation substrates when possible

    • Design model substrates with signal sequences optimized for thermophilic systems

    • Compare translocation efficiency with mesophilic substrates to assess specificity

  • Assay Development:

    • Modify standard translocation assays to function at higher temperatures

    • Develop real-time monitoring methods compatible with thermophilic conditions

    • Include appropriate controls for spontaneous membrane permeability at higher temperatures

  • System Composition:

    • Determine whether to study SecF alone or as part of the SecDF complex

    • Consider reconstituting the complete T. terrenum Sec translocon (SecYEG-SecDF)

    • Compare homologous systems from mesophilic organisms to identify thermophilic adaptations

  • Energy Coupling:

    • Investigate how proton motive force coupling functions at elevated temperatures

    • Examine ATP requirements for SecA-dependent translocation at different temperatures

    • Study the efficiency of energy coupling in thermophilic versus mesophilic systems

Studies of other T. terrenum proteins have shown that careful consideration of these factors is essential for meaningful results, as demonstrated in the characterization work on T. terrenum LMCOs .

What challenges might researchers encounter when working with recombinant T. terrenum SecF, and how can these be addressed?

Researchers working with recombinant T. terrenum SecF may encounter several challenges, with corresponding mitigation strategies:

  • Expression Challenges:

    • Challenge: Membrane proteins often express poorly in heterologous systems

    • Solution: Optimize codons for E. coli, use specialized strains (C41/C43), lower induction temperatures (16-25°C), and employ fusion tags (e.g., SUMO, MBP) to enhance solubility

  • Folding and Stability Issues:

    • Challenge: Achieving correct folding in mesophilic expression hosts

    • Solution: Co-express with chaperones, implement heat-shock protocols post-expression, use specialized folding additives

  • Solubilization and Purification Difficulties:

    • Challenge: Finding appropriate detergents for extraction while maintaining native conformation

    • Solution: Screen multiple detergents (DDM, LMNG, GDN), implement detergent exchange during purification, consider native nanodiscs or SMALPs for extraction

  • Activity Assessment:

    • Challenge: Developing functional assays that work at both mesophilic and thermophilic temperatures

    • Solution: Design comparative assays with temperature controls, incorporate fluorescent reporters that function across temperature ranges

  • Reconstitution Problems:

    • Challenge: Achieving functional reconstitution in artificial membrane systems

    • Solution: Optimize lipid compositions, incorporate lipids from thermophiles, adjust protein-to-lipid ratios, use gradual removal of detergents

  • System Complexity:

    • Challenge: SecF functions as part of a multi-component system

    • Solution: Consider co-expression and co-purification with interaction partners, develop reconstitution protocols for the complete system

  • Thermal Instability During Experimental Manipulation:

    • Challenge: Protein may aggregate during experimental procedures, especially if detergent concentration fluctuates

    • Solution: Maintain strict temperature control, incorporate stabilizing additives, work quickly during critical steps

Experience with other T. terrenum proteins indicates that while expression and initial handling may present challenges, the inherent thermostability often provides advantages during later experimental stages, as seen with T. terrenum LMCOs .

How can non-canonical amino acid incorporation be utilized to enhance studies of T. terrenum SecF?

Non-canonical amino acid (ncAA) incorporation represents an advanced approach for studying T. terrenum SecF with several potential applications:

  • Site-Specific Labeling for Structural Studies:

    • Incorporate photocrosslinking ncAAs (like p-benzoyl-L-phenylalanine) to capture transient protein-protein interactions within the Sec complex

    • Introduce fluorescent ncAAs for single-molecule FRET studies of conformational changes during the translocation cycle

    • Use paramagnetic ncAAs for EPR distance measurements in membrane environments

  • Probing the Translocation Mechanism:

    • Incorporate ncAAs at key positions in the translocation channel to identify substrate contact points

    • Use photoactivatable ncAAs to capture substrates during translocation

    • Introduce environment-sensitive ncAAs to monitor local changes during the transport cycle

  • Enhanced Stability and Function:

    • Replace selected amino acids with fluorinated variants to increase hydrophobicity and thermostability

    • Incorporate ncAAs with unique properties to enhance function beyond the limit of the 20 canonical amino acids

    • Design variants with improved pH or solvent tolerance through strategic ncAA placement

  • Methodological Approach:
    The incorporation of ncAAs into T. terrenum SecF would follow established protocols:

    • Generate TAG codon variants at positions of interest using site-directed mutagenesis

    • Co-transform expression hosts with:

      • The modified secF gene containing TAG codons

      • An orthogonal aminoacyl-tRNA synthetase/tRNA pair specific for the desired ncAA

    • Express in the presence of the ncAA (typically 1-5 mM)

    • Induce expression with controlled IPTG concentrations (0.1-0.5 mM)

    • Purify using standard protocols with consideration for any special properties of the incorporated ncAA

  • Specific ncAA Systems:
    Several established ncAA incorporation systems could be applied:

    • PylRS-derived systems for incorporation of lysine analogs

    • TyrRS/TrpRS-derived systems for aromatic ncAAs

    • pEVOL-pBpARS system for incorporating p-benzoyl-L-phenylalanine

This approach has been successfully demonstrated with other proteins, including enzymes from thermophilic organisms, where ncAA incorporation has led to enhanced functionality beyond what is possible with the standard amino acid repertoire .

What statistical approaches are recommended for analyzing thermal stability data of T. terrenum SecF compared to mesophilic homologs?

When analyzing thermal stability data for T. terrenum SecF compared to mesophilic homologs, researchers should consider the following statistical approaches:

  • Thermal Denaturation Curve Analysis:

    • Fit denaturation curves to appropriate models (two-state, multi-state) using non-linear regression

    • Calculate and compare Tm values (melting temperatures) with confidence intervals

    • Apply statistical tests (t-test, ANOVA) to determine significance of Tm differences between variants

    • Consider using Boltzmann sigmoidal fitting for thermal shift assays

  • Activity-Based Thermal Stability:

    • Generate Arrhenius plots to determine activation energies

    • Compare T50 values (temperature at which 50% activity remains after fixed incubation)

    • Apply appropriate regression models for thermal inactivation kinetics

    • Account for potential heat activation phenomena, which have been observed in other T. terrenum proteins

  • Comparative Data Analysis:

    • Use multivariate analysis to correlate thermal stability with multiple structural parameters

    • Implement hierarchical clustering to identify patterns across homologs from different thermal environments

    • Apply principal component analysis to identify key factors contributing to thermostability

  • Time-Dependent Thermal Stability:

    • Analyze half-life at elevated temperatures using first-order decay models

    • Compare thermal inactivation rates using appropriate kinetic models

    • Account for biphasic behavior that may occur due to domain-specific unfolding

  • Statistical Considerations:

    • Ensure adequate replication (minimum n=3) for reliable statistical analysis

    • Test for normality and homogeneity of variance before applying parametric tests

    • Consider non-parametric alternatives when assumptions for parametric tests are not met

    • Report effect sizes alongside p-values to indicate practical significance

When studying thermal stability of LMCOs from T. terrenum, researchers noted that heat activation phenomena complicated thermal stability measurements, requiring careful experimental design and specialized analytical approaches . Similar considerations may apply to SecF studies.

How should researchers interpret changes in SecF structure-function relationships across different temperature ranges?

When interpreting changes in SecF structure-function relationships across different temperature ranges, researchers should consider:

Research on other thermostable proteins from T. terrenum has shown complex relationships between temperature, structure, and function, with properties like EPR spectra changing upon heat treatment, suggesting conformational rearrangements that affect activity .

What approaches can be used to analyze the evolutionary adaptations in T. terrenum SecF that contribute to its thermostability?

To analyze evolutionary adaptations in T. terrenum SecF that contribute to thermostability, researchers can employ several complementary approaches:

  • Comparative Sequence Analysis:

    • Perform multiple sequence alignment of SecF homologs from organisms across temperature ranges

    • Identify conserved residues in thermophiles that differ from mesophiles

    • Apply statistical coupling analysis to identify co-evolving residues

    • Use ancestral sequence reconstruction to trace evolutionary paths to thermostability

  • Phylogeny-Based Methods:

    • Construct phylogenetic trees of SecF across bacterial phyla

    • Map thermal growth optima onto phylogenetic trees

    • Apply comparative phylogenetic methods to identify convergent evolution

    • Consider the evolutionary history of Chloroflexi phylum, to which T. terrenum belongs

  • Structural Bioinformatics:

    • Calculate and compare stability parameters (hydrogen bonds, salt bridges, hydrophobic contacts)

    • Perform in silico mutagenesis to predict stabilizing/destabilizing substitutions

    • Apply energy calculation algorithms to estimate folding stability differences

    • Use molecular dynamics simulations at different temperatures to identify stabilizing interactions

  • Experimental Validation Strategies:

    • Create chimeric proteins between thermophilic and mesophilic SecF to map thermostability determinants

    • Perform systematic mutagenesis to test predicted stabilizing features

    • Measure activity and stability of variants to correlate sequence features with thermal adaptation

    • Implement directed evolution under thermal selection to identify convergent solutions

  • Specialized Analytical Frameworks:

    • Use machine learning approaches to identify subtle patterns in sequence-stability relationships

    • Apply network analysis to understand how local changes affect global stability

    • Implement ensemble-based computational methods to account for conformational diversity

    • Consider models that incorporate both thermodynamic and kinetic stability factors

T. terrenum's position in the Chloroflexi phylum, which represents one of the earliest branches of bacterial evolution , makes its proteins particularly valuable for studying ancient thermal adaptations. Comparative analysis with both contemporary thermophiles and mesophiles could provide insights into convergent evolution of thermostability.

What are common pitfalls in the expression and purification of T. terrenum SecF, and how can they be resolved?

Researchers working with T. terrenum SecF may encounter several common pitfalls during expression and purification, with corresponding solutions:

  • Low Expression Yields:

    • Pitfall: Poor expression of foreign membrane protein in E. coli

    • Solution: Optimize codon usage for E. coli, reduce expression temperature to 16-20°C, try different E. coli strains (BL21, C41/C43, Rosetta), use lower IPTG concentrations (0.1-0.5 mM), and consider autoinduction media

  • Inclusion Body Formation:

    • Pitfall: Protein aggregates in insoluble fraction

    • Solution: Express with fusion partners (MBP, SUMO, Trx), lower induction temperature, reduce expression rate with lower IPTG, co-express with chaperones, consider periplasmic targeting

  • Poor Membrane Integration:

    • Pitfall: Expressed protein fails to integrate properly into membranes

    • Solution: Verify signal sequence is not obstructed by tags, ensure translation rate matches integration capacity by lowering expression, consider expression hosts with more robust membrane protein machinery

  • Inefficient Solubilization:

    • Pitfall: Low recovery during detergent extraction

    • Solution: Screen multiple detergents in parallel (DDM, LMNG, LDAO, Fos-choline), optimize detergent:protein ratio, extend solubilization time, incorporate lipids during solubilization

  • Co-purification of Contaminants:

    • Pitfall: Contaminant proteins persist through purification

    • Solution: Implement stringent washing steps with higher imidazole concentrations (30-50 mM), add secondary purification steps (ion exchange, size exclusion), consider dual-tag purification approaches

  • Protein Instability During Purification:

    • Pitfall: Protein degradation during purification process

    • Solution: Work at 4°C, add protease inhibitors, reduce purification time, maintain adequate detergent concentration throughout, avoid multiple freeze-thaw cycles

  • Poor Recovery After Buffer Exchange:

    • Pitfall: Protein loss during concentration or buffer exchange

    • Solution: Ensure detergent concentration remains above CMC, use low protein-binding membranes, pre-treat surfaces with detergent solution, consider alternative concentration methods

  • Aggregation During Storage:

    • Pitfall: Protein aggregates during storage

    • Solution: Add glycerol (up to 50%), aliquot to avoid freeze-thaw cycles, store at -80°C for long-term storage, keep working aliquots at 4°C for limited periods

Similar challenges have been addressed in the purification of other membrane proteins from T. terrenum, suggesting that implementing these solutions should improve outcomes with SecF purification.

How can researchers optimize reconstitution protocols for functional studies of T. terrenum SecF?

Optimizing reconstitution protocols for functional studies of T. terrenum SecF requires careful consideration of several parameters:

  • Lipid Composition Selection:

    • Screen lipid compositions mimicking T. terrenum membranes (if known)

    • Test lipids with varying acyl chain lengths and saturation levels

    • Consider including specialized lipids (cardiolipin, archaeal-type lipids) that may enhance stability at high temperatures

    • Optimize cholesterol or ergosterol content for membrane fluidity at experimental temperatures

  • Protein-to-Lipid Ratio Optimization:

    • Test multiple ratios (typically ranging from 1:50 to 1:2000 w/w)

    • Determine optimal density by functional assays and/or freeze-fracture electron microscopy

    • Consider that thermophilic membrane proteins may require different optimal densities than mesophilic counterparts

  • Detergent Removal Methods:

    • Compare different detergent removal techniques:

      • Dialysis (gentle but time-consuming)

      • Adsorption to Bio-Beads or Amberlite (faster but less controlled)

      • Cyclodextrin complexation (rapid and controllable)

      • Dilution (simple but may result in heterogeneous preparations)

    • Optimize removal rate (particularly important for complex membrane proteins)

  • Buffer and Additive Optimization:

    • Test buffers with different pH values around physiological pH for T. terrenum

    • Screen various salt concentrations to promote proper folding

    • Consider adding stabilizing agents (glycerol, sucrose, specific ions)

    • Test reagents that mimic the cytoplasmic environment of T. terrenum

  • Co-reconstitution Strategies:

    • For functional studies, co-reconstitute with other components of the Sec system

    • Optimize the stoichiometry of different components based on native ratios if known

    • Consider sequential reconstitution approaches for complex assemblies

    • Ensure oriented insertion by using pH gradients or other techniques

  • Quality Control Metrics:

    • Verify reconstitution efficiency using:

      • Freeze-fracture electron microscopy for protein distribution

      • Dynamic light scattering for size homogeneity

      • Sucrose gradient centrifugation for density

      • Fluorescence recovery after photobleaching for lateral mobility

    • Assess functionality using translocation assays with appropriate controls

  • Thermostability Considerations:

    • Ensure all components (lipids, buffers) are stable at experimental temperatures

    • Consider preconditioning proteoliposomes at elevated temperatures to stabilize the system

    • Implement temperature-controlled steps throughout the reconstitution process

When developing reconstitution protocols, researchers should draw from experience with other thermostable membrane proteins, adapting methods to account for the unique properties of proteins from organisms like T. terrenum that thrive at temperatures around 67°C .

How can researchers effectively troubleshoot activity assays for T. terrenum SecF when results differ from expectations?

When troubleshooting activity assays for T. terrenum SecF that yield unexpected results, researchers should implement a systematic approach:

  • Temperature-Related Issues:

    • Problem: Activity lower than expected at T. terrenum's physiological temperature (67°C)

    • Troubleshooting:

      • Verify all assay components are thermostable at the test temperature

      • Check for temperature gradient effects in reaction vessels

      • Consider temperature-dependent changes in buffer pH

      • Ensure adequate pre-equilibration of all components at the test temperature

      • Test for potential heat activation phenomena, as observed with other T. terrenum proteins

  • Detergent Interference:

    • Problem: Detergent affecting activity measurements

    • Troubleshooting:

      • Test multiple detergent types and concentrations

      • Consider detergent-free systems (nanodiscs, SMALPs)

      • Implement controls to account for detergent effects on assay components

      • Ensure detergent concentration remains constant throughout the assay

  • Reconstitution Quality Issues:

    • Problem: Poor activity in reconstituted systems

    • Troubleshooting:

      • Verify protein orientation in liposomes using protease protection assays

      • Confirm membrane integrity using leakage assays

      • Check protein:lipid ratios and optimize as needed

      • Assess liposome size distribution and homogeneity

  • Component Interaction Problems:

    • Problem: Incomplete Sec system reconstruction

    • Troubleshooting:

      • Verify all necessary components are present at appropriate ratios

      • Test interactions between components using pull-down assays

      • Consider the need for additional factors (chaperones, signal recognition particle)

      • Implement controls with well-characterized Sec systems from model organisms

  • Substrate-Related Issues:

    • Problem: Poor substrate recognition or translocation

    • Troubleshooting:

      • Test multiple substrate proteins, including native T. terrenum secretory proteins if available

      • Verify signal sequence recognition at experimental temperatures

      • Optimize substrate concentration and presentation

      • Include positive controls with known translocation competence

  • Energy Coupling Concerns:

    • Problem: Inefficient energy utilization

    • Troubleshooting:

      • Verify ATP quality and concentration for SecA-dependent processes

      • Check proton motive force generation in reconstituted systems

      • Optimize Mg²⁺ concentration for ATPase activity

      • Consider temperature effects on energy coupling mechanisms

  • Analytical Method Limitations:

    • Problem: Assay limitations at elevated temperatures

    • Troubleshooting:

      • Adapt detection methods for high-temperature compatibility

      • Implement internal standards to control for temperature effects on detection

      • Consider alternative readouts less affected by temperature

      • Use time-resolved measurements to capture transient activities

When interpreting unexpected results, researchers should consider that T. terrenum proteins may exhibit specialized adaptations to their native thermophilic environment, potentially including activation mechanisms, cofactor requirements, or structural transitions that differ from mesophilic counterparts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.