Recombinant Thermobifida fusca ATP synthase subunit b (atpF)

What is Thermobifida fusca ATP synthase subunit b and what is its role in cellular metabolism?

Thermobifida fusca ATP synthase subunit b (atpF) is a protein component of the F-type ATP synthase complex in this thermophilic soil bacterium. The protein functions as part of the F0 sector of ATP synthase, which is embedded in the membrane and forms the proton channel. As indicated by its annotation (gene name atpF, locus name Tfu_2411), this subunit plays a critical role in the structural stability of the ATP synthase complex and participates in the process of coupling proton translocation to ATP synthesis .

The complete protein consists of 179 amino acids and contains multiple functional domains, including membrane-spanning regions that facilitate its integration into the cell membrane. Within the context of T. fusca's energy metabolism, ATP synthase represents a crucial link between the proton gradient generated during cellular respiration and the synthesis of ATP, which serves as the primary energy currency for cellular processes .

How does recombinant T. fusca ATP synthase subunit b compare structurally to ATP synthase subunits from other thermophilic bacteria?

Recombinant T. fusca ATP synthase subunit b shares structural similarities with ATP synthase subunits from other thermophilic organisms, but with distinct adaptations that reflect T. fusca's moderately thermophilic nature (optimal growth at approximately 55°C). The amino acid sequence (mLGLAAEENVLRIHIDELVFGLIAFAVIFALVYRYAVPRVTKmLDERADAIEGGIERAKK AEAEAEELRQQFQEKLEEAHRSYAAELQKASEQSAAIIAEAREEAQAEARRIIEAAHAQI EADRQQAMAQLRAEIGALSADLAARIVGETLSDPAAQSRVIDRFLAELESGANQQAEVR) reveals features typical of thermostable proteins, including a higher proportion of charged residues that can form stabilizing ionic interactions .

When conducting comparative analyses, researchers should consider examining hydrophobic core packing, surface charge distribution, and potential disulfide bonds that may contribute to the protein's thermostability. These structural characteristics directly influence the protein's functionality in different experimental conditions and its potential applications in biotechnological processes.

What expression systems are commonly used for producing recombinant T. fusca ATP synthase subunit b?

Various expression systems can be employed for producing recombinant T. fusca ATP synthase subunit b, with E. coli being the most commonly utilized host. Based on established protocols for other T. fusca proteins, effective expression typically involves:

• Vector selection: Plasmids containing thermoinducible promoters (such as λpRpL) or IPTG-inducible promoters (T7-based systems) allow controlled expression .

• Fusion strategies: Incorporating fusion tags such as His6 facilitates purification while signal sequences like OmpA can direct protein secretion to the periplasmic space, potentially improving folding and stability .

• Cultivation conditions: Both batch and fed-batch cultivations can yield recombinant proteins, though their efficiency in protein localization may differ significantly. In batch cultures, proteins directed to the periplasm are often completely released into the extracellular medium, while in fed-batch cultivations, a substantial portion (approximately 65%) may remain in the cytoplasm .

When establishing an expression system for recombinant T. fusca ATP synthase subunit b, researchers should consider optimization of temperature, induction parameters, and growth media composition to maximize protein yield while maintaining proper folding and activity.

What are the biophysical mechanisms underlying the thermostability of T. fusca ATP synthase subunit b, and how can these be experimentally validated?

The thermostability of T. fusca ATP synthase subunit b likely derives from several structural and biophysical mechanisms that could be experimentally validated through various approaches:

• Amino acid composition analysis: The protein sequence of T. fusca ATP synthase subunit b contains multiple alanine-rich regions and charged residues that may form stabilizing salt bridges. The sequence (mLGLAAEENVLRIHIDELVFGLIAFAVIFALVYRYAVPRVTK...) suggests hydrophobic interactions in the membrane-spanning regions and potential ionic interactions in the cytoplasmic domain .

• Experimental validation approaches:

  • Circular dichroism spectroscopy to assess secondary structure stability at increasing temperatures

  • Differential scanning calorimetry to determine melting temperature and unfolding energetics

  • Proteolytic susceptibility assays comparing wild-type and mutant variants

  • Molecular dynamics simulations to identify key stabilizing interactions

• Comparative mutagenesis: Introducing mutations that alter charged residues or hydrophobic packing could help identify critical regions for thermostability.

Understanding these mechanisms has broader implications for protein engineering and could inform the design of thermostable proteins for biotechnological applications.

What are the optimal conditions for expressing and purifying functional recombinant T. fusca ATP synthase subunit b?

Expressing and purifying functional recombinant T. fusca ATP synthase subunit b requires carefully optimized conditions based on the protein's characteristics and intended application. Drawing from successful expression protocols for other T. fusca proteins, the following conditions are recommended:

Expression conditions:

• Vector system: pCYTEXP1 or similar expression vectors with thermo-inducible promoters (λpRpL)

• Host strain: E. coli TG1 or BL21(DE3) for high expression yield

• Growth temperature: 30°C for initial growth phase, followed by temperature induction at 42°C

• Media composition: Rich media (e.g., LB) for initial studies; defined media for controlled expression

• Induction parameters: Temperature shift from 30°C to 42°C for thermo-inducible promoters or IPTG addition (0.5-1.0 mM) for T7-based systems

Purification protocol:

• Cell lysis: Sonication (10% strength, 5 minutes) in ice bath to preserve protein structure

• Initial purification: Ni-NTA affinity chromatography for His6-tagged protein

• Buffer composition: Tris-based buffer (pH 8.0) containing glycerol for stability

• Storage conditions: -20°C for short-term or -80°C for extended storage in 50% glycerol

Important considerations:

• Avoid repeated freeze-thaw cycles as this may compromise protein integrity

• Working aliquots should be stored at 4°C for up to one week

• The protein localization pattern differs between batch and fed-batch cultivation, which may impact purification strategy

What spectroscopic and biochemical assays can be used to characterize the structural integrity and functional activity of purified recombinant T. fusca ATP synthase subunit b?

Characterizing recombinant T. fusca ATP synthase subunit b requires a combination of spectroscopic and biochemical approaches to assess both structural integrity and functional properties:

Structural characterization:

• Circular dichroism (CD) spectroscopy: Provides information about secondary structure content and thermal stability

• Fourier-transform infrared spectroscopy (FTIR): Complements CD by detecting secondary structure elements, particularly useful for membrane proteins

• Dynamic light scattering (DLS): Evaluates size distribution and potential aggregation states

• Limited proteolysis combined with mass spectrometry: Identifies flexible regions and domain organization

Functional characterization:

• ATP hydrolysis assay: Measures ATPase activity when reconstituted with other ATP synthase subunits

• Proton translocation assays: Uses pH-sensitive fluorescent dyes to monitor proton movement through reconstituted complexes

• Binding assays with other ATP synthase subunits: Surface plasmon resonance or isothermal titration calorimetry to determine interaction affinities

Membrane association:

• Liposome incorporation efficiency: Quantifies the protein's ability to insert into lipid bilayers

• Fluorescence anisotropy with labeled protein: Assesses mobility and membrane integration

These methodologies provide comprehensive information about the protein's structural integrity and functional capacity, enabling researchers to correlate structure with function and evaluate the impact of experimental modifications.

What strategies can be employed to optimize the solubility and stability of recombinant T. fusca ATP synthase subunit b during expression and purification?

Optimizing solubility and stability of recombinant T. fusca ATP synthase subunit b requires addressing its hydrophobic nature and membrane protein characteristics. Several strategies have proven effective for similar proteins:

Expression optimization:

• Fusion partners: Incorporate solubility-enhancing tags such as MBP (maltose-binding protein), SUMO, or TrxA (thioredoxin)

• Secretion signals: The OmpA leader sequence can direct the protein to the periplasmic space, improving folding and potentially enhancing solubility

• Expression temperature: Lower temperatures (16-25°C) after induction can reduce inclusion body formation

• Induction intensity: Reduced inducer concentration and slower expression rates often improve folding

Solubility enhancement:

• Detergent screening: Systematic testing of detergents (mild non-ionic detergents like DDM or LMNG) for optimal extraction from membranes

• Lipid addition: Including lipids during purification can stabilize membrane proteins

• Buffer optimization: Testing various buffers, salt concentrations, and additives (glycerol, arginine, proline) to improve solubility

Stability considerations:

• Storage buffer: Tris-based buffer with 50% glycerol has been documented to maintain stability

• Antioxidants: Addition of reducing agents (DTT, β-mercaptoethanol) to prevent oxidative damage

• Proteolysis prevention: Including protease inhibitors during early purification steps

Experimental strategy table:

Implementing a systematic approach to test these variables will help identify optimal conditions for maintaining the structural integrity and functionality of the recombinant protein.

How can researchers effectively analyze and interpret ATP synthase activity data from recombinant T. fusca ATP synthase subunit b in comparison to other bacterial ATP synthases?

Effective analysis and interpretation of ATP synthase activity data require a structured approach that considers the unique characteristics of T. fusca as a moderate thermophile. When comparing recombinant T. fusca ATP synthase subunit b activity with other bacterial systems, researchers should:

Data normalization approaches:

• Activity normalization by protein concentration to enable direct comparison between preparations

• Temperature correction to account for differential temperature optima between mesophilic and thermophilic ATP synthases

• Substrate affinity normalization (Km values) to meaningfully compare kinetic parameters

Comparative analysis framework:

• Create reference datasets using well-characterized ATP synthases (E. coli, Bacillus PS3, thermophilic Bacillus species)

• Develop activity ratio metrics (e.g., activity at 55°C vs. 37°C) to quantify thermostability advantages

• Plot Arrhenius relationships to determine activation energies and compare temperature dependence

Statistical approaches:

• Multiple regression analysis to identify factors that significantly influence activity

• Principal component analysis to detect patterns in multivariate datasets

• Analysis of variance to determine significant differences between experimental conditions

Interpreting T. fusca-specific characteristics:
The moderate thermophilic nature of T. fusca (optimal growth at 55°C) positions its ATP synthase between mesophilic and extreme thermophilic enzymes . When interpreting activity data, consider that T. fusca has evolved specific adaptations that may lead to unique kinetic properties, stability profiles, and regulatory mechanisms compared to either mesophilic or extreme thermophilic ATP synthases.

What bioinformatic approaches can be used to analyze the evolutionary conservation of T. fusca ATP synthase subunit b and predict structure-function relationships?

Bioinformatic analysis of T. fusca ATP synthase subunit b can provide valuable insights into its evolutionary conservation and structure-function relationships. Recommended approaches include:

Sequence analysis tools:

• Multiple sequence alignment (MSA) with ATP synthase subunit b sequences from diverse bacterial species

• Conservation analysis to identify invariant residues across phylogenetic groups

• Coevolution analysis to detect residue pairs that may have functional or structural relationships

Structural prediction methods:

• Secondary structure prediction using algorithms like PSIPRED or JPred

• Transmembrane topology prediction using TMHMM or MEMSAT

• Homology modeling based on available ATP synthase structures

• Ab initio modeling for regions with low sequence similarity to known structures

Functional motif identification:

• Search for known functional motifs using databases like PROSITE or PFAM

• Analysis of the sequence (mLGLAAEENVLRIHIDELVFGLIAFAVIFALVYRYAVPRVTK...) for patterns associated with specific ATP synthase subunit b functions

• Identification of potential protein-protein interaction sites with other ATP synthase components

Evolutionary analysis:

• Phylogenetic tree construction to understand the relationship of T. fusca ATP synthase subunit b to orthologs in other species

• Estimation of selective pressure (dN/dS ratio) across the protein sequence

• Ancestral sequence reconstruction to infer evolutionary trajectories

These bioinformatic approaches can guide experimental design by highlighting regions of particular interest for mutagenesis studies and providing context for interpreting experimental observations about protein function and stability.

How can researchers integrate structural data with functional assays to understand the mechanism of T. fusca ATP synthase subunit b in the context of the complete ATP synthase complex?

Integrating structural and functional data for T. fusca ATP synthase subunit b requires a multidisciplinary approach that combines various experimental and computational methods:

Structural-functional integration methodology:

• Cross-linking studies paired with mass spectrometry:

  • Chemical cross-linking to identify proximity relationships between ATP synthase subunits

  • Mass spectrometric analysis to map contact points and interaction interfaces

  • Correlation of cross-linking data with functional alterations upon mutation

• Cryo-EM and subcomplex reconstitution:

  • Structural determination of the complete ATP synthase complex

  • Visualization of subunit b positioning within the F0 sector

  • Comparison of structures with varying subunit compositions to determine assembly contribution

• Site-directed mutagenesis guided by structural predictions:

  • Target conserved residues identified through bioinformatic analysis

  • Analyze the effects of mutations on both structural integrity and enzymatic function

  • Develop structure-function maps based on mutational data

• Molecular dynamics simulations:

  • Model the behavior of subunit b within membrane environments

  • Simulate interactions with other ATP synthase components

  • Predict conformational changes during catalytic cycles

Data integration framework:

By systematically integrating these various data types, researchers can develop comprehensive models that explain how the structural features of T. fusca ATP synthase subunit b contribute to its function within the ATP synthase complex, particularly under the thermophilic conditions in which T. fusca thrives.

How can the thermostable properties of T. fusca ATP synthase subunit b be leveraged for developing novel bioenergetic systems or biotechnological applications?

The thermostable properties of T. fusca ATP synthase subunit b offer significant potential for biotechnological applications, particularly in developing robust bioenergetic systems that can operate under challenging conditions. Leveraging these properties involves:

Fundamental research applications:

• Development of thermostable ATP synthase hybrid complexes by incorporating T. fusca components into mesophilic systems

• Engineering of minimalistic ATP synthase systems with enhanced stability for fundamental mechanistic studies

• Creation of bionanotechnology devices that utilize the proton transport capabilities in sensor applications

Biotechnological applications:

• Biosensors for ATP detection that function reliably at elevated temperatures

• Bioenergy systems capable of maintaining function in industrial biotechnology processes

• Template systems for rational design of other thermostable membrane proteins

Research approach for application development:

• Characterize the specific thermostable elements of the T. fusca ATP synthase subunit b structure

• Develop chimeric proteins incorporating these thermostable elements into other systems

• Test functionality and stability of engineered systems under varied conditions

• Optimize expression and reconstitution protocols for scaled production

The moderately thermophilic nature of T. fusca (optimal growth at 55°C) places its ATP synthase in a particularly valuable niche - more thermostable than mesophilic versions but potentially more flexible than extreme thermophile proteins, offering a balance of stability and functionality for biotechnological applications .

What are the most significant technical challenges in studying membrane-associated proteins like T. fusca ATP synthase subunit b, and what emerging technologies might address these limitations?

Studying membrane-associated proteins like T. fusca ATP synthase subunit b presents several significant technical challenges, with emerging technologies offering promising solutions:

Current technical challenges:

• Expression and purification difficulties:

  • Low expression yields in heterologous systems

  • Challenges in extracting and purifying intact membrane proteins

  • Maintaining native-like lipid environments during isolation

• Structural determination obstacles:

  • Difficulties in obtaining crystals for X-ray crystallography

  • Size limitations for NMR studies

  • Technical challenges in cryo-EM sample preparation

• Functional characterization limitations:

  • Complexity in reconstituting functional membrane protein complexes

  • Challenges in measuring activity in artificial membrane systems

  • Difficulty differentiating between direct and indirect effects in mutagenesis studies

Emerging technologies and solutions:

• Advanced expression systems:

  • Cell-free protein synthesis systems optimized for membrane proteins

  • Specialized E. coli strains with enhanced membrane protein production capacity

  • Nanodiscs and amphipols for stabilizing membrane proteins outside native membranes

• Modern structural biology approaches:

  • Advances in cryo-EM for membrane protein complexes without crystallization

  • Integrative structural biology combining multiple techniques (SAXS, EM, crosslinking MS)

  • Computational prediction methods specifically for membrane proteins

• New functional analysis tools:

  • Microfluidic systems for high-throughput functional assays

  • Single-molecule techniques to observe conformational changes

  • Advanced fluorescence approaches (FRET, fluorescence correlation spectroscopy)

When working with T. fusca ATP synthase subunit b, researchers should consider leveraging these emerging technologies, particularly those that can accommodate the protein's thermophilic nature and membrane association characteristics. Experimental designs that incorporate multiple complementary approaches will likely yield the most comprehensive insights.

What are the future research directions and unanswered questions regarding T. fusca ATP synthase subunit b that could lead to significant advancements in understanding bioenergetic systems?

Future research on T. fusca ATP synthase subunit b offers several promising directions that could substantially advance our understanding of bioenergetic systems:

Fundamental questions requiring investigation:

• How does the structure of T. fusca ATP synthase subunit b contribute to thermostability while maintaining functional flexibility?

• What are the specific protein-protein interactions between subunit b and other components of the ATP synthase complex?

• How does T. fusca ATP synthase regulate its activity in response to changing environmental conditions?

• What role does post-translational modification play in the function and regulation of T. fusca ATP synthase subunit b?

Innovative research approaches:

• Development of genetic tools specifically for T. fusca to enable in vivo studies of ATP synthase function

• Application of advanced labeling techniques for single-molecule studies of subunit dynamics during catalysis

• Engineering of chimeric ATP synthase complexes combining components from different thermophilic and mesophilic organisms

• Comprehensive comparative analysis of ATP synthase structure and function across the temperature adaptation spectrum

Potential applications of findings:

• Design principles for engineering thermostable membrane proteins for biotechnological applications

• Insights into bioenergetic adaptation mechanisms that could inform synthetic biology approaches

• Development of novel antimicrobial targets based on structural differences between bacterial and eukaryotic ATP synthases