Recombinant Thermobifida fusca Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
crcB1; Tfu_3029; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Thermobifida fusca (strain YX)
Target Names
crcB1
Target Protein Sequence
MTALLTAVGAAFGALLRYCLNCAAAARGTTGFPWGTWCVNTLGCLLAGALAALPLPAAVA ALAGPGLCGGLTTYSTFSYETVRLLAERKWTHALGNIGANLAAGVGAAVLGMAAVGWFLR
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration and mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Thermobifida fusca and why is it significant in research?

Thermobifida fusca is a moderate thermophilic soil bacterium with an optimal growth temperature of 55°C. It plays a major role in degrading plant cell walls in heated organic materials such as compost heaps, rotting hay, manure piles, and mushroom growth medium. It was previously named Thermomonaspora fusca and belongs to the actinomycete family. T. fusca produces spores that can be allergenic and cause a condition called farmer's lung. The organism has gained significant research interest due to its extracellular enzymes, particularly cellulases, which exhibit remarkable thermostability, function across a broad pH range (4-10), and demonstrate high enzymatic activity. T. fusca can degrade most major plant cell wall polymers except lignin and pectin, and can utilize most simple sugars and carboxylic acids as carbon sources .

What expression systems are recommended for recombinant CrcB1 production?

For recombinant production of T. fusca CrcB1, Escherichia coli expression systems are predominantly used. The recombinant protein described in the literature features an N-terminal His-tag and encompasses the full-length protein (amino acids 1-120). When selecting an E. coli strain for CrcB1 expression, researchers should consider strains optimized for membrane protein expression, as CrcB1's putative function as a fluoride ion transporter suggests it is membrane-associated. The amino acid composition, with numerous hydrophobic residues, further supports its membrane protein characteristics .

What are the optimal conditions for protein purification and storage?

The purification of recombinant T. fusca CrcB1 typically employs affinity chromatography targeting the N-terminal His-tag. For researchers working with this protein, the following storage and handling recommendations should be observed:

ParameterRecommended ConditionNotes
Storage temperature-20°C/-80°CAliquoting is necessary for multiple use
Storage formLyophilized powderPrior to opening, briefly centrifuge to bring contents to bottom
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Add 5-50% glycerol (final concentration) for long-term storage
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0Helps maintain protein stability
Working storage4°CFor up to one week
Important cautionAvoid repeated freeze-thaw cyclesCan lead to protein degradation and activity loss

These conditions are designed to maintain protein stability and activity during storage and handling .

How does the structure of CrcB1 relate to its function as a fluoride ion transporter?

While specific structural data for T. fusca CrcB1 is not directly available in the literature, analysis of its amino acid sequence reveals features consistent with membrane transport proteins. The 120-amino acid sequence contains hydrophobic segments that likely form transmembrane domains, essential for creating a passage for fluoride ions across cellular membranes.

By comparison with other prokaryotic fluoride channels, we can infer that CrcB1 likely functions as part of the cell's defense mechanism against fluoride toxicity. Fluoride ions can inhibit enzymes containing magnesium, such as enolase, making fluoride resistance crucial for bacteria in environments with elevated fluoride levels. The transmembrane regions of CrcB1 would create a selective channel that allows fluoride ions to be exported from the cytoplasm, thereby maintaining intracellular fluoride at non-toxic levels .

How might the thermophilic nature of T. fusca influence CrcB1 properties?

T. fusca is a moderate thermophile with an optimal growth temperature of 55°C, which suggests that its proteins, including CrcB1, have evolved structural adaptations for thermostability. Research on the effects of growth temperature on T. fusca has shown that temperature significantly affects the fatty acid profiles produced by this bacterium . This temperature-dependent modulation of membrane composition likely influences the environment in which membrane proteins like CrcB1 function.

Thermostable proteins typically exhibit features such as increased hydrophobic interactions, additional salt bridges, and more compact structures compared to their mesophilic counterparts. For researchers working with CrcB1, this thermostability may offer practical advantages, such as increased tolerance to varied experimental conditions and potentially longer shelf-life of the purified protein .

What assays can be implemented to analyze CrcB1 transport activity?

For researchers investigating the functional properties of T. fusca CrcB1, several methodological approaches can be considered:

  • Fluoride-Selective Electrode Measurements: This direct method can quantify fluoride transport in reconstituted systems. Proteoliposomes containing purified CrcB1 can be prepared, and fluoride flux can be measured over time using a fluoride-selective electrode.

  • Growth Complementation Assays: Expression of T. fusca CrcB1 in bacterial strains sensitive to fluoride (such as crcB knockout strains) can demonstrate functional complementation if growth is restored in fluoride-containing media.

  • Fluorescent Probe-Based Assays: Fluoride-sensitive fluorescent probes can be used in liposome-based systems to monitor real-time transport activity of reconstituted CrcB1.

  • Isothermal Titration Calorimetry (ITC): This technique can provide information about the binding affinity of fluoride ions to CrcB1 and thermodynamic parameters of the interaction.

Each method offers specific advantages and limitations, and researchers may need to employ multiple approaches to comprehensively characterize CrcB1 transport activity.

What are the key considerations for crystallization trials of CrcB1?

Crystallization of membrane proteins like CrcB1 presents significant challenges that researchers should address through methodical approaches:

  • Protein Purity and Homogeneity: Achieving >95% purity is typically necessary for successful crystallization. Size-exclusion chromatography following initial affinity purification can help ensure monodispersity.

  • Detergent Selection: Testing a panel of detergents is crucial, as detergent choice significantly impacts membrane protein crystallization. Common starting points include n-Dodecyl β-D-maltoside (DDM), n-Decyl-β-D-maltopyranoside (DM), and lauryl maltose neopentyl glycol (LMNG).

  • Lipid Supplementation: Including specific lipids can stabilize the protein and promote crystal contacts. Screening with various lipids (phosphatidylcholine, phosphatidylethanolamine, etc.) may improve crystallization outcomes.

  • Temperature Optimization: Given T. fusca's thermophilic nature, crystallization trials at elevated temperatures (20-37°C) might yield better results than traditional 4°C setups.

  • Crystallization Technique Selection: Vapor diffusion, lipidic cubic phase (LCP), and bicelle methods should all be considered, as membrane proteins often crystallize preferentially in specific setups.

  • Construct Optimization: Engineering constructs with reduced flexibility or fusion partners that promote crystallization (such as T4 lysozyme or BRIL) may be necessary if initial trials fail.

How can molecular dynamics simulations enhance our understanding of CrcB1 function?

Molecular dynamics (MD) simulations offer powerful tools for investigating the structural dynamics and functional mechanisms of membrane transporters like CrcB1. Researchers can implement the following methodological approach:

  • Homology Model Development: Using the amino acid sequence provided , researchers can develop homology models based on structurally characterized CrcB homologs from other species.

  • Membrane Embedding Simulation: The protein model should be embedded in a lipid bilayer that mimics the T. fusca membrane composition, with particular attention to the fatty acid profile variations observed at different temperatures .

  • Fluoride Transport Simulation: Applying advanced sampling techniques such as steered MD or umbrella sampling can help characterize the energy landscape of fluoride transport through the channel.

  • Temperature-Dependent Simulations: Running simulations at different temperatures (e.g., 37°C and 55°C) can reveal thermally-induced conformational changes that might be relevant to CrcB1's function in a thermophilic organism.

  • Electrostatic Analysis: Calculating the electrostatic potential throughout the channel can identify regions important for fluoride selectivity and transport.

These simulations can generate testable hypotheses about specific residues involved in fluoride binding and transport, guiding subsequent mutagenesis studies.

How does the CRISPR-Cas system in T. fusca relate to CrcB1 function?

While T. fusca possesses a CRISPR-Cas system, exemplified by the characterized Cse1 protein that is involved in target DNA binding and recognition , direct functional relationships between this system and CrcB1 have not been established in the available literature. Nevertheless, understanding the broader context of bacterial defense mechanisms provides valuable research perspectives:

Both CRISPR-Cas systems and fluoride transporters like CrcB1 represent distinct defense strategies employed by bacteria. The CRISPR-Cas system provides adaptive immunity against invading genetic elements such as bacteriophages , while CrcB1 likely functions in detoxification of environmental fluoride.

For researchers investigating bacterial defense systems holistically, considering how these systems might be coordinately regulated under various stress conditions could provide novel insights. For instance, examining whether exposure to fluoride affects expression of CRISPR-Cas components, or whether viral infection alters expression of detoxification systems like CrcB1, could reveal unexplored regulatory connections in bacterial defense networks.

What approaches can be used to investigate CrcB1 regulation in response to environmental conditions?

Understanding how T. fusca regulates CrcB1 expression in response to different environmental conditions requires multi-faceted experimental approaches:

  • Transcriptional Analysis: RT-qPCR or RNA-seq can quantify crcB1 transcript levels under varying conditions, such as different fluoride concentrations or growth temperatures. The thermophilic nature of T. fusca suggests temperature-dependent regulation may be particularly significant .

  • Promoter Analysis: Characterizing the crcB1 promoter region and identifying potential transcription factor binding sites can provide insights into regulatory mechanisms. Reporter gene assays with the native promoter can verify regulatory elements.

  • Proteomic Analysis: Quantitative proteomics comparing protein expression in T. fusca grown under different conditions can reveal how CrcB1 protein levels respond to environmental factors and correlate with other cellular components.

  • Gene Knockout Studies: Creating a crcB1 knockout strain of T. fusca and assessing its growth under various conditions, particularly in the presence of fluoride, can elucidate the physiological role of CrcB1.

  • Metabolic Profiling: Comparing the metabolome of wild-type and crcB1 mutant strains under various growth conditions can reveal downstream metabolic effects of CrcB1 function or dysfunction.

This multi-omics approach would provide comprehensive insights into how CrcB1 is integrated into T. fusca's response to environmental challenges.

How does T. fusca CrcB1 compare to fluoride transporters in other thermophilic bacteria?

Comparative analysis of CrcB1 from T. fusca with homologs from other thermophilic bacteria provides evolutionary insights and may reveal thermostability-associated adaptations. The following methodological approach is recommended:

  • Sequence Alignment and Phylogenetic Analysis: Align the T. fusca CrcB1 sequence with homologs from other thermophiles and mesophiles to identify conserved regions and thermophile-specific variations.

  • Hydrophobicity Profile Comparison: Analyze and compare hydrophobicity profiles to identify differences in transmembrane domain organization between thermophilic and mesophilic CrcB homologs.

  • Comparative Structural Modeling: Generate structural models of multiple CrcB homologs and compare features such as salt bridge distributions, hydrogen bonding networks, and surface charge distributions.

  • Thermal Stability Assays: Express and purify multiple CrcB homologs and compare their thermal denaturation profiles using techniques such as differential scanning fluorimetry (DSF) or circular dichroism (CD) spectroscopy.

  • Functional Comparison: Assess fluoride transport activity across a temperature range for CrcB homologs from different species to identify functional adaptations to temperature.

These approaches can reveal specific adaptations that enable fluoride transporters to function in thermophilic environments, potentially informing protein engineering efforts for enhanced stability.

What technical challenges exist when comparing in vitro and in vivo functions of CrcB1?

Reconciling in vitro characterization with in vivo function of CrcB1 presents several methodological challenges that researchers should address:

  • Membrane Environment Differences: The artificial membrane systems used for in vitro studies may not accurately reproduce the native membrane environment of T. fusca, which has unique fatty acid profiles that vary with growth conditions . Researchers should consider incorporating native-like lipid compositions in reconstitution experiments.

  • Temperature-Dependent Effects: Standard laboratory assays are often performed at lower temperatures than T. fusca's optimal growth temperature (55°C) . In vitro experiments should be conducted at physiologically relevant temperatures to accurately assess CrcB1 function.

  • Regulatory Network Absence: In vitro systems lack the regulatory networks that may modulate CrcB1 activity in vivo. Researchers should consider supplementary approaches to identify potential regulatory interactions.

  • Protein Modifications: Post-translational modifications that might occur in vivo may be absent in recombinant protein produced in E. coli . Mass spectrometry analysis of native CrcB1 could identify any such modifications.

  • Experimental Validation Strategy: A robust approach combines in vitro characterization, heterologous expression studies (in fluoride-sensitive strains), and genetic manipulation of T. fusca itself to provide a comprehensive understanding of CrcB1 function.

By systematically addressing these challenges, researchers can develop a more complete and physiologically relevant understanding of CrcB1 function.

How might structural studies of CrcB1 inform the development of fluoride channel inhibitors?

Structural characterization of T. fusca CrcB1 could provide valuable insights for the rational design of fluoride channel inhibitors, following this methodological framework:

  • Structure Determination Strategy: Pursue multiple structural approaches, including X-ray crystallography, cryo-electron microscopy, and NMR spectroscopy, to characterize CrcB1 structure. The thermostable nature of T. fusca proteins may provide advantages for structural studies .

  • Binding Site Identification: Use computational methods such as molecular docking or fragment-based screening to identify potential binding sites for small molecules that could block fluoride transport.

  • Structure-Activity Relationship (SAR) Development: Design and test a series of compounds with systematic structural variations to establish correlations between molecular features and inhibitory activity.

  • Validation in Multiple Systems: Test candidate inhibitors in both purified protein systems (such as proteoliposomes) and in cellular contexts to confirm mechanism of action.

  • Selectivity Profiling: Assess inhibitor activity against multiple fluoride transporters to determine selectivity and identify structural features that confer specificity.

These studies could lead to the development of chemical probes for studying fluoride transport mechanisms and potentially to new antimicrobial strategies targeting fluoride channels in pathogenic bacteria.

What potential biotechnological applications exist for thermostable fluoride transporters like CrcB1?

The thermostable nature of T. fusca CrcB1 suggests several innovative biotechnological applications:

  • Fluoride Bioremediation Systems: Engineered microorganisms expressing thermostable CrcB1 could be developed for bioremediation of fluoride-contaminated environments, particularly in industrial settings where elevated temperatures are present.

  • Biosensor Development: CrcB1 could be incorporated into biosensor platforms for detecting fluoride in environmental or industrial samples, with the thermostability allowing for robust field applications.

  • Industrial Process Protection: Expression of thermostable CrcB1 in industrial microorganisms could enhance their resistance to fluoride, potentially improving performance in processes where fluoride contamination is a concern.

  • Protein Engineering Template: The structural features conferring thermostability to T. fusca CrcB1 could inform engineering efforts to enhance stability of other membrane proteins for biotechnological applications.

  • Crystallization Chaperone: Thermostable proteins sometimes serve as effective crystallization chaperones when fused to proteins that are difficult to crystallize. CrcB1 could potentially serve as such a tool for structural biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.