Recombinant Thermococcus gammatolerans Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in your order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are sent with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
cobS; TGAM_0538; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
Target Names
cobS
Target Protein Sequence
MRNLLPFFTRIPVKGDFERVRNELWALPLLAPLTSALATLVLYLELPLSNVLAILALYFT TGLLHLDGLADWADGVMVKGDRERKIKAMKDLNTGIAGVFAVVMVFLLQVYSLPLLPFYA LYLAELNSKFAMLLALATRKPLGQGLGAYFMEGMNGRQLTLGTALYLLLLLPVAYIEPRS ISSLLGLLAGAYVIRLSLRNFGGLNGDCIGAVAEITRAGALLGMAVVWVYFGG
Uniprot No.

Target Background

Function
Cobalamin synthase (cobS) from *Thermococcus gammatolerans* catalyzes the final two steps in cobalamin biosynthesis. It joins adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). Additionally, it synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Thermococcus gammatolerans and why is it significant for cobalamin-related research?

Thermococcus gammatolerans is a gram-negative archaeon extremophile discovered in 2003 from submarine hydrothermal vents in the Guaymas Basin. It is the most radiation-resistant organism known to exist, capable of withstanding gamma radiation doses up to 30,000 gray (Gy) without losing viability . This hyperthermophile thrives optimally at 88°C and pH 6, favoring environments where it can reduce sulfur to hydrogen sulfide .

The extreme resistance properties of T. gammatolerans make its enzymes, including cobalamin synthase (CobS), particularly interesting for researchers. The organism's ability to maintain protein function and DNA integrity under extreme conditions suggests that its enzymes may possess unique structural and functional characteristics. Since cobalamin (vitamin B12) is essential for various metabolic processes, studying CobS from such an extremophile could provide insights into both cobalamin biosynthesis under extreme conditions and potential applications in biotechnology requiring thermostable enzymes.

How does Cobalamin Synthase (CobS) function in the context of archaeal metabolism?

Cobalamin Synthase (CobS) plays a crucial role in the biosynthesis pathway of cobalamin (vitamin B12) in archaea like T. gammatolerans. In the cobalamin biosynthetic pathway, CobS catalyzes a key step in the assembly of the corrin ring structure, specifically the incorporation of cobalt into the corrin ring.

In archaea such as T. gammatolerans, cobalamin-dependent enzymes are essential for various metabolic processes. For instance, search results indicate the presence of cobalamin-dependent methionine synthase, a key enzyme in methionine and folate one-carbon metabolism . The methionine synthase contains specialized domains that bind substrates including homocysteine (HCY), methyltetrahydrofolate (MTF), and S-adenosylmethionine (SAM), as well as the cobalamin cofactor .

The presence of genes related to cobalt transport, such as tg1801 encoding CbiQ (a putative cobalt transport protein), suggests that T. gammatolerans has mechanisms to acquire the cobalt needed for cobalamin synthesis . Understanding CobS function therefore requires consideration of both the enzyme's catalytic activity and its integration within the broader metabolic network of archaeal cells.

What expression patterns of CobS have been observed in T. gammatolerans under different conditions?

While the provided search results don't specifically detail CobS expression patterns, we can infer potential regulatory patterns based on related studies of T. gammatolerans gene expression under various stress conditions.

Research on T. gammatolerans exposure to cadmium (Cd) revealed regulation of metal-related transport systems. Notably, genes encoding cobalt transport proteins showed differential expression under metal stress. The gene tg1801, encoding CbiQ (a putative cobalt transport protein), was upregulated in the presence of 1 mM cadmium . This suggests that metal stress may indirectly affect cobalamin biosynthesis through alteration of cobalt availability.

The organism's transcriptional response to radiation exposure may also provide insights, as T. gammatolerans can resist gamma radiation doses up to 5.0 kGy without loss of viability . Given that radiation induces oxidative stress and DNA damage, pathways maintaining cofactor homeostasis (potentially including cobalamin) may be regulated under these conditions.

Comparative transcriptional analyses have shown that while T. gammatolerans exhibits specific responses to different stressors (Cd, Zn, Ni, heat shock, γ-rays), metal stress transcriptional patterns are often similar to each other but distinct from general stress responses . This suggests that CobS expression might follow patterns similar to other metal-dependent enzymes when studied under various conditions.

How do the structural and functional properties of T. gammatolerans CobS compare to those from mesophilic organisms?

T. gammatolerans CobS likely possesses unique structural adaptations that contribute to its stability and function under extreme conditions. While specific structural data for T. gammatolerans CobS is not provided in the search results, we can draw inferences based on general principles of protein adaptation in extremophiles.

Proteins from hyperthermophiles like T. gammatolerans (optimal growth at 88°C) typically exhibit increased hydrophobic interactions, additional salt bridges, more compact packing, and reduced flexible loops compared to mesophilic counterparts . These adaptations enhance thermostability while maintaining catalytic function at high temperatures.

Additionally, T. gammatolerans' remarkable radiation resistance (up to 30,000 Gy) suggests its proteins may have enhanced resistance to oxidative damage . The basal level of oxidative damage in T. gammatolerans (9.2 ± 0.9 8-oxo-dGuo per 10^6 nucleosides) is higher than in eukaryotic cells or bacteria, yet the organism efficiently repairs this damage . This suggests that its proteins, including CobS, may either be inherently resistant to oxidative modification or function effectively despite such modifications.

For researchers seeking to express recombinant T. gammatolerans CobS, understanding these adaptations is crucial for designing expression systems that maintain the enzyme's native properties. Expression in mesophilic hosts may require optimization of temperature, redox conditions, and potentially cofactor availability to ensure proper folding and function.

What challenges are encountered when expressing recombinant T. gammatolerans CobS in heterologous systems?

Expressing recombinant enzymes from hyperthermophilic archaea like T. gammatolerans in conventional mesophilic hosts presents several significant challenges:

  • Codon usage discrepancies: T. gammatolerans, as an archaeon, has different codon preferences compared to bacterial expression hosts like E. coli. This may necessitate codon optimization for efficient translation.

  • Protein folding at suboptimal temperatures: Since T. gammatolerans thrives at 88°C, its enzymes may not fold properly at the lower temperatures used for cultivating common expression hosts (typically 30-37°C) . Researchers have successfully addressed similar challenges with other extremophile enzymes by using cold-shock expression systems or heat-treatment steps during purification.

  • Post-translational modifications: If archaeal-specific modifications are required for CobS activity, these may be absent in bacterial or eukaryotic expression systems.

  • Cofactor availability: Cobalamin biosynthesis involves multiple cofactors and metal ions, particularly cobalt. The expression host must provide adequate concentrations of these cofactors for recombinant enzyme function. The regulation of cobalt transport proteins in T. gammatolerans under stress conditions suggests metal homeostasis is important for related pathways .

  • Solubility and stability issues: Hyperthermophilic proteins may aggregate or exhibit reduced solubility when expressed at lower temperatures. Fusion tags (His, MBP, GST) can improve solubility but may affect enzyme activity.

Successful expression of other T. gammatolerans enzymes has been reported, such as the DNA repair enzymes TGAM_1277 and TGAM_1653, which were heterologously produced and purified with their functional activities maintained . These precedents suggest that with appropriate optimization, recombinant CobS expression is feasible.

How might the radiation resistance mechanisms of T. gammatolerans influence CobS stability and function?

T. gammatolerans exhibits exceptional radiation resistance, withstanding doses up to 30,000 Gy, which suggests its cellular components, including enzymes like CobS, possess remarkable stability under oxidative stress conditions .

Several mechanisms potentially contributing to CobS stability under radiation stress can be inferred from studies of T. gammatolerans:

  • Efficient DNA repair systems: T. gammatolerans possesses effective DNA repair mechanisms, including base excision repair (BER) enzymes like TGAM_1277 and TGAM_1653, which repair oxidative DNA lesions . While these systems don't directly protect proteins, they ensure continued expression of functional enzymes after radiation exposure.

  • Potential protein protection mechanisms: The organism likely possesses systems to protect proteins from radiation-induced damage or to remove damaged proteins. These mechanisms would be crucial for maintaining CobS function under radiation stress.

  • Metal homeostasis during stress: Studies show that T. gammatolerans regulates metal transporters under stress conditions, including those for cobalt (e.g., tg1801 encoding CbiQ) . Since CobS requires cobalt for its function in cobalamin synthesis, maintained metal homeostasis during stress would support continued enzyme activity.

  • Constitutive expression of redox homeostasis genes: Unlike other organisms, redox homeostasis genes in T. gammatolerans appear to be constitutively expressed rather than induced under stress . This suggests a constant state of preparedness for oxidative challenges, which would benefit metalloproteins like CobS.

The robust stress response systems of T. gammatolerans likely contribute to maintaining CobS stability and function under conditions that would inactivate enzymes from less resistant organisms. This makes T. gammatolerans CobS potentially valuable for applications requiring enzyme activity under harsh conditions.

What are the optimal conditions for assaying recombinant T. gammatolerans CobS activity?

Assaying recombinant T. gammatolerans CobS activity requires careful consideration of the enzyme's extremophilic origin. Based on the organism's characteristics and related enzyme studies, the following conditions should be considered:

  • Temperature optimization: Since T. gammatolerans grows optimally at 88°C with a range of 55-95°C, CobS activity assays should initially be tested at elevated temperatures . A temperature gradient experiment (60-95°C) is recommended to determine the optimal temperature for enzymatic activity.

  • pH considerations: T. gammatolerans has an optimal growth pH of 6 . Initial assays should be conducted at this pH, with a recommended range of pH 5.5-7.0 for comprehensive characterization.

  • Anaerobic conditions: As T. gammatolerans is an anaerobic organism that reduces sulfur to hydrogen sulfide, enzyme assays should ideally be performed under anaerobic conditions . Oxygen exposure may adversely affect enzyme activity or stability.

  • Buffer composition: Buffers containing sulfur compounds may be beneficial, reflecting the organism's natural environment. Additionally, stabilizing agents may be necessary when working at elevated temperatures.

  • Metal requirements: Ensure adequate cobalt availability for CobS activity, as it is essential for cobalamin synthesis. The upregulation of cobalt transport proteins (tg1801) under stress conditions suggests the importance of cobalt homeostasis .

  • Substrate considerations: Depending on the specific reaction catalyzed by CobS in the cobalamin biosynthetic pathway, appropriate substrates must be provided at concentrations that reflect physiological conditions.

For accurate assessment of enzyme kinetics, monitoring methods such as spectrophotometric assays, HPLC analysis of reaction products, or coupled enzyme assays may be employed, with modifications to accommodate the high-temperature reaction conditions.

What purification strategies are most effective for obtaining high-quality recombinant T. gammatolerans CobS?

Purifying recombinant T. gammatolerans CobS requires strategies that address the unique properties of this hyperthermophilic archaeal enzyme. Based on successful approaches with other extremophilic enzymes and information about T. gammatolerans, the following purification strategies are recommended:

  • Heat treatment exploitation: A significant advantage when purifying enzymes from hyperthermophiles is the ability to use heat treatment as an initial purification step. After cell lysis, heating the crude extract to 70-80°C for 15-30 minutes will denature most mesophilic host proteins while leaving the thermostable CobS intact. This step can achieve substantial purification with minimal loss of target enzyme activity.

  • Affinity chromatography options:

    • His-tag affinity chromatography using Ni-NTA or TALON resins is effective for many recombinant archaeal proteins

    • If cobalt is important for CobS function (as suggested by the upregulation of cobalt transport proteins ), consider using cobalt-based affinity media

  • Ion exchange chromatography: Given T. gammatolerans' optimal growth at pH 6 , CobS likely has distinctive charge properties. Anion exchange (e.g., Q-Sepharose) at pH 7-8 or cation exchange (e.g., SP-Sepharose) at pH 5-6 can be effective, depending on the enzyme's isoelectric point.

  • Size exclusion chromatography: As a final polishing step, gel filtration can separate the target enzyme from aggregates and smaller contaminants while providing information about the enzyme's oligomeric state.

  • Specialized considerations:

    • Maintain anaerobic conditions throughout purification if oxygen sensitivity is observed

    • Include reducing agents (DTT, β-mercaptoethanol) to protect potential sensitive cysteine residues

    • Consider adding stabilizing agents like glycerol (10-20%) or specific metal ions

The successful heterologous production and purification of other T. gammatolerans enzymes, such as the DNA repair enzymes TGAM_1277 and TGAM_1653 , suggests that with appropriate optimization, high-quality recombinant CobS can be obtained using these strategies.

How can researchers effectively analyze the interaction between T. gammatolerans CobS and other enzymes in the cobalamin biosynthetic pathway?

Analyzing interactions between T. gammatolerans CobS and other enzymes in the cobalamin biosynthetic pathway requires approaches that account for the extremophilic nature of these proteins while providing reliable interaction data. Based on modern interaction analysis techniques and information about T. gammatolerans, the following strategies are recommended:

  • Co-expression and co-purification studies:

    • Design co-expression systems for CobS and potential partner enzymes

    • Use dual-affinity tag strategies (e.g., His-tag on CobS and Strep-tag on partner enzymes)

    • Sequential affinity purification can isolate intact complexes

    • The successful heterologous production of other T. gammatolerans enzymes suggests this approach is feasible

  • Thermostable protein-protein interaction methods:

    • Surface Plasmon Resonance (SPR) modified for high-temperature measurements

    • Isothermal Titration Calorimetry (ITC) with temperature control to match physiological conditions (up to 88°C)

    • Microscale Thermophoresis (MST) for quantifying interactions under near-native conditions

  • Structural biology approaches:

    • X-ray crystallography of CobS alone and in complex with partner proteins

    • Cryo-electron microscopy (cryo-EM) of larger assemblies

    • These methods could provide insights similar to those obtained for cobalamin-dependent methionine synthase structure

  • Bioinformatic analyses:

    • Genome neighborhood analysis to identify genes clustered with cobS

    • Comparison with the known organization of tg1801 (cbiQ), tg1802 (bioM), and tg1804 (bioY) as observed in the tripartite biotin transporter

    • Protein-protein interaction prediction based on conserved domains and structural modeling

  • Functional coupling assays:

    • Develop coupled enzyme assays that monitor the sequential activities of multiple enzymes in the pathway

    • Observe how perturbation of one enzyme affects the activity of others in the reconstituted system

    • Investigate whether metal stress responses, such as those observed with cadmium exposure , affect enzyme interactions

By combining these approaches, researchers can build a comprehensive understanding of how CobS interacts with other enzymes in the cobalamin biosynthetic pathway under the extreme conditions preferred by T. gammatolerans.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.