Recombinant Thermococcus gammatolerans Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Genomic Features of T. gammatolerans

FeatureValue
Genome size2,045,438 bp
Coding regions94%
GC content53.6%
Total CDSs2,157
Gene overlap frequency11% (237 genes)

The secD gene (locus TGAM_0284) is part of a conserved operon involved in protein translocation .

Functional Role in the Sec Translocase System

The SecD subunit operates as part of the SecDF-YajC complex, which:

  1. Stabilizes membrane proteins during translocation.

  2. Enhances proton motive force-driven post-translational secretion .

  3. Collaborates with SecYEG to form a channel for substrate proteins .

Key interactions:

  • Binds SecF via transmembrane helices.

  • Coordinates with SecY to regulate substrate release .

Biochemical Properties

ParameterSpecification
Molecular weight~60 kDa (calculated)
Purity>85% (SDS-PAGE verified)
Storage bufferTris-based + 50% glycerol
StabilityStable at -20°C/-80°C

Critical notes:

  • Repeated freeze-thaw cycles degrade functionality .

  • Working aliquots retain activity for ≤7 days at 4°C .

Research Applications

  1. Membrane protein studies: Used to reconstitute archaeal Sec translocase in vitro.

  2. Extremophile adaptation: Investigated for thermal/radiation resistance mechanisms .

  3. Industrial biotechnology: Explored for high-temperature enzymatic processes .

Comparative Genomics Insights

T. gammatolerans SecD shares 76.7%–77.2% sequence identity with other Thermococcus species but only 71.2%–72.8% with Pyrococcus homologs . This divergence reflects evolutionary adaptations to distinct hydrothermal niches.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery timelines may vary based on the purchase method and location. For accurate delivery estimates, please consult your local distributor.
Note: All protein shipments are standardly packed with blue ice packs. For dry ice delivery, please contact us in advance, as additional fees may apply.
Notes
Avoid repeated freezing and thawing cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotation at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a reference point for your convenience.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid protein maintains a shelf life of 6 months at -20°C/-80°C. Lyophilized protein typically exhibits a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Repeated freeze-thaw cycles should be minimized.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is selected during production. If you have a specific tag requirement, please inform us, and we will prioritize the development of your desired tag.
Synonyms
secD; TGAM_0284; Protein-export membrane protein SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-525
Protein Length
full length protein
Species
Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
Target Names
secD
Target Protein Sequence
MARKKGVKALLLNWRVLLLILFLIGSVVSMSIKGLTYGIDIGGGVALIAEPEKPVSKDTL NGIITSLQNRLNTFGVKDITIEAQHDPETGQSLIVVKIANVTLDEANQIKDLIESQGVLY MEFNGVIFATGTDVTVHSSDYGLDLQECPTCWYVGFELSGKAQNKFKKIAAGKLGWPIDI YLDPPVNSLLVVSPRVYQEMNSGDFMGAPSEGTPKPLVERLKEAFNITVVEYSNQTAEDI VENATALGKDKIILADVPEELYNDVRELVLSKDLKLRVSHYTPQQGEDLKDFVKRILNLY GPYVLKFDPAKGETTRLKLSGSAPTKEEALQEARKIYSVLRSGSLAVKLHVVSEEYISPT LGASFKKQAIIAGIGALIAVLLIVYFHYRRWRIAIPVASTSLFEVIIILGIAALIRWNLD LPSIAGIIAAIGTGVDQQIVITDELLGGTAGRVTRRMSALRRMARAFFIIFASAATTIVA MSFLLVYFVGTLKGFAVTTILGVLIGVLVTRPAYAEIAKYLLSLE
Uniprot No.

Target Background

Function
Plays a crucial role in protein export.
Database Links
Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of SecD in Thermococcus gammatolerans?

The SecD protein in T. gammatolerans is encoded within its 2.045 Mbp circular chromosome . While specific information about the SecD gene organization is not directly detailed in current literature, researchers should note that T. gammatolerans shares 1,660 genes with T. kodakaraensis KOD1 and 1,489 genes with T. onnurineus NA1 . Comparative genomic analysis would be valuable for identifying the SecD gene locus and its potential operon structure. When working with this gene, consider examining conserved synteny patterns with other Thermococcales to confirm gene boundaries and regulatory elements.

How does the extreme radioresistance of T. gammatolerans potentially affect SecD structure and function?

T. gammatolerans can survive radiation doses of up to 5 kGy without detectable lethality, suggesting its proteins may possess intrinsic radiation resistance mechanisms . Research on T. gammatolerans PCNA (Proliferating Cell Nuclear Antigen) revealed structural features that confer radioresistance, including a high percentage of charged residues (particularly negatively charged), a proportion of glutamate more than double that of aspartate, absence of cysteines and tryptophan, and numerous salt bridges . These characteristics may similarly apply to SecD. Researchers should consider incorporating radiation exposure experiments in their SecD studies to determine if this protein contributes to the organism's exceptional radiation tolerance or possesses similar structural adaptations as observed in PCNA.

What experimental approaches are recommended for studying the thermostability of recombinant T. gammatolerans SecD?

Given that T. gammatolerans grows optimally at 88°C , its SecD protein likely exhibits significant thermostability. Researchers should employ differential scanning calorimetry (DSC) and circular dichroism (CD) spectroscopy at various temperatures to establish thermal denaturation profiles. Additionally, functional assays at different temperatures (ranging from 60-95°C) using reconstituted membrane systems would provide insights into temperature-dependent activity. When designing these experiments, ensure that buffer components remain stable at high temperatures and consider including control proteins from mesophilic organisms for comparative analysis.

What expression systems are most appropriate for producing recombinant T. gammatolerans SecD?

For basic characterization studies, E. coli expression systems with T7-based vectors are suitable, though codon optimization may be necessary due to the archaeal origin of the gene. For more advanced functional studies, consider using archaeal expression hosts such as Thermococcus kodakaraensis or Sulfolobus systems that provide a more native-like environment. When expressing hyperthermophilic membrane proteins like SecD, initial expression trials should test various fusion tags (His, MBP, SUMO) and expression temperatures (typically 18-30°C for E. coli) to optimize soluble protein yield and proper folding.

What purification challenges are specific to T. gammatolerans SecD and how can they be addressed?

As a membrane protein component, SecD presents purification challenges related to solubility and stability. Researchers should:

  • Employ a two-step solubilization approach using mild detergents (DDM, LMNG)

  • Include stabilizing agents like glycerol (10-20%) and specific lipids in purification buffers

  • Consider nanodiscs or amphipol reconstitution for functional studies

  • Implement size exclusion chromatography as a final purification step to ensure homogeneity

For crystallography purposes, detergent screening is critical, while for cryo-EM studies, reconstitution into nanodiscs has shown superior results for membrane protein complexes.

How can researchers verify the proper folding and functionality of recombinant T. gammatolerans SecD?

Proper folding assessment should combine multiple approaches:

Verification MethodTechnical ApproachExpected Results
Secondary structureFar-UV circular dichroismα-helical pattern consistent with membrane proteins
Thermal stabilityDifferential scanning fluorimetryMelting temperature >80°C expected
HomogeneitySize exclusion chromatographySingle major peak with appropriate retention volume
FunctionalityATPase activity assaysATP hydrolysis in presence of SecYEG components
Protein translocationIn vitro translocation assaysSuccessful translocation of model substrates

Additionally, limited proteolysis can identify properly folded domains through resistance to digestion at domain boundaries.

What structural features might contribute to the thermostability and potential radiation resistance of T. gammatolerans SecD?

Based on structural patterns observed in T. gammatolerans PCNA , researchers should examine:

  • Amino acid composition analysis for enrichment of charged residues (particularly Glu)

  • Reduction or absence of radiation-sensitive residues (Cys, Trp)

  • Potential salt bridge networks contributing to structural stability

  • Hydrophobic core packing that might differ from mesophilic homologs

Advanced experimental approaches should include hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions of high structural rigidity and molecular dynamics simulations to understand stabilizing interactions under extreme conditions.

How might SecD function be affected by the metal-rich hydrothermal vent environment of T. gammatolerans?

T. gammatolerans exhibits high resistance to cadmium, cobalt, and zinc, with moderate tolerance to nickel, copper, and arsenate . This metal tolerance suggests potential adaptations in membrane proteins, including SecD. Researchers should:

  • Investigate metal binding sites within the SecD structure

  • Conduct metal tolerance assays with recombinant SecD in the presence of various metals

  • Perform bioinformatic analysis comparing metal-binding motifs with mesophilic SecD homologs

  • Consider how metal ions might influence SecD's interaction with other Sec components

Experimental designs should include activity assays in the presence of various metal ions to determine inhibitory or stimulatory effects relevant to the organism's natural environment.

What methodological approaches are appropriate for studying the interactions between T. gammatolerans SecD and other components of the Sec translocase system?

For comprehensive interaction studies, researchers should employ:

  • Pull-down assays using tagged recombinant proteins to identify stable complexes

  • Surface plasmon resonance or microscale thermophoresis to determine binding affinities

  • Crosslinking mass spectrometry to map interaction interfaces

  • Reconstitution experiments in proteoliposomes to assess functional interactions

When designing these experiments, consider the high temperature optimum of T. gammatolerans (88°C) and develop assay conditions that maintain protein stability while allowing for meaningful interaction measurements.

How does T. gammatolerans SecD compare with homologs from other archaeal species, particularly within Thermococcales?

T. gammatolerans shares significant genomic content with other Thermococcales, with 1,156 genes conserved across the six sequenced Thermococcales genomes . Researchers should:

  • Perform multiple sequence alignments of SecD sequences from various Thermococcales

  • Identify conserved and divergent regions that might relate to specific environmental adaptations

  • Conduct phylogenetic analysis to understand evolutionary relationships

  • Compare gene neighborhood structures to identify potential operon conservation

This comparative approach will help identify unique features of T. gammatolerans SecD that might contribute to the organism's extreme environmental tolerance.

What can the study of T. gammatolerans SecD reveal about protein translocation mechanisms in extremophiles?

Advanced research questions should address how extreme conditions influence translocation machinery:

  • How does high temperature affect the kinetics of SecD-dependent translocation?

  • Are there specific substrate preferences or exclusions in the T. gammatolerans Sec pathway?

  • How does the membrane composition of a hyperthermophile influence SecD function?

  • Are there extremophile-specific adaptations in the ATP coupling mechanism of the Sec system?

Addressing these questions requires reconstituted systems using native-like lipid compositions and temperature-controlled translocation assays with various substrate proteins.

How should researchers design radiation exposure experiments to study the potential radioresistance of T. gammatolerans SecD?

Given T. gammatolerans' exceptional radiation resistance (surviving up to 5 kGy) , experimental designs should:

  • Include dose-response curves ranging from 0-10 kGy using gamma radiation

  • Compare structural integrity pre- and post-irradiation using spectroscopic methods

  • Assess functional activity retention following radiation exposure

  • Include control proteins from radiation-sensitive organisms

Carefully consider sample preparation, as buffer components may generate reactive oxygen species during irradiation that could confound results.

What are the key considerations when setting up membrane protein crystallization trials for T. gammatolerans SecD?

For crystallization of this challenging membrane protein:

ParameterRecommendationRationale
Detergent selectionScreen multiple (DDM, LMNG, UDM)Different detergents affect crystal contacts
TemperatureInclude trials at 4°C and 18°CTemperature affects protein stability and crystal growth
Additive screeningInclude lipids and metalsNative environment components may stabilize structure
Protein engineeringConsider creating crystallizable constructsRemove flexible regions that hinder crystal formation

Additionally, consider lipidic cubic phase (LCP) crystallization as an alternative approach for membrane proteins, which has proven successful for many challenging targets.

What potential biotechnological applications might emerge from studying T. gammatolerans SecD?

Advanced research applications include:

  • Developing thermostable protein secretion systems for industrial enzyme production

  • Engineering radiation-resistant protein production platforms for specialized applications

  • Creating chimeric translocase systems with enhanced stress tolerance

  • Utilizing structural insights for designing stable membrane protein expression systems

When pursuing these applications, researchers should focus on identifying the specific structural and functional features that confer extreme stability to T. gammatolerans proteins.

How might cryo-electron microscopy approaches be optimized for studying the T. gammatolerans Sec translocase complex?

For cryo-EM studies of this challenging complex:

  • Use nanodiscs or amphipols rather than detergent micelles for better contrast

  • Consider GraFix (gradient fixation) to stabilize transient complexes

  • Employ time-resolved cryo-EM to capture translocation intermediates

  • Use focused refinement techniques to resolve flexible domains

Sample preparation should account for the thermophilic nature of the complex, possibly including brief incubation at elevated temperatures before vitrification.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.