Recombinant Thermococcus gammatolerans Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Conformational Dynamics

  • Adopts three primary conformations: super membrane-facing (super-F), membrane-facing (F), and intermediate (I) states .

  • Interacts with SecYEG translocon, increasing the population of the I conformation by 9× upon binding, which correlates with enhanced protein translocation activity .

  • Transmembrane helices (TM4, TM5, TM6, TM10) form a channel facilitating precursor protein movement .

Proton Gradient Utilization

  • Leverages proton motive force (PMF) to drive post-translational protein secretion .

  • Critical residues like Asp365 in TM5 regulate proton-coupled conformational changes .

Production and Purification Protocol

Recombinant SecF is generated through the following optimized process:

StepDetails
  1. Cloning | secF gene (TGAM_0283) amplified from T. gammatolerans genomic DNA .

  2. Expression | Induced in E. coli BL21(DE3) using IPTG at 37°C .

  3. Purification | Nickel-affinity chromatography under denaturing/native conditions .

  4. Formulation | Lyophilized in Tris/PBS buffer with 6% trehalose for stability .

Research Applications

  • Protein Translocation Studies: Used to reconstitute archaeal Sec systems in synthetic lipid bilayers for AFM-based mechanistic analyses .

  • Thermostability Assays: Retains 93% activity after 1 hr at 95°C, making it suitable for high-temperature biochemical applications .

  • Antibody Production: Serves as an antigen for generating SecF-specific antibodies .

Comparative Genomic Insights

The secF gene in T. gammatolerans shares 71–77% sequence identity with homologs in other Thermococcus species but exhibits unique adaptations:

  • Radioresistance Linkage: Co-occurs with specialized DNA repair systems in the genome .

  • Operon Organization: Located adjacent to secD and other secretion-related genes (e.g., TGAM_0281–TGAM_0285) .

Limitations and Future Directions

  • Current structural models lack resolution for the full SecYEG-SecDF holocomplex.

  • Functional redundancy with SecD requires conditional knockout studies for definitive role assignment .

  • Industrial applications in extremophile protein secretion systems remain underexplored .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
secF; TGAM_0283; Protein-export membrane protein SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
Target Names
secF
Target Protein Sequence
MGTKKQKTKKKPSDEILETKRKRLSFLVRMEPRKMVLYPLVVFLVAALILAVHFPEKGID LKGGVVVTVYHVSASPDELASYVKEKTGIDVRAEEFKDPITGLSGIRIYAPAKTAPSKIA DEISNAIRLKYKDADVTPRVVDPTFGKIAQKQGIKAVIYAFIGMAIVVFLFFRDPVPSGT IIFSAFSDMVIALATMGILGIELTTATIAALLMLIGYTVDSNILLTTRLLRRKEDTIEDA YLSAVSTGFTMSTTTLGALFILWLVSTSEVIDSITIVLIFGLLADFMNTWIFNAGVLRWY IASPLKFSIKLRRGK
Uniprot No.

Target Background

Function
Involved in protein export.
Database Links
Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Thermococcus gammatolerans and what makes it significant for protein research?

Thermococcus gammatolerans is a strictly anaerobic, hyperthermophilic archaeon belonging to the order Thermococcales in the phylum Euryarchaeota. It was first isolated from a submarine hydrothermal vent in the Guaymas Basin off the coast of Baja California at a depth of approximately 2,600 meters . This extremophile is particularly significant for protein research due to its exceptional radiation resistance, being able to withstand gamma radiation doses up to 30,000 Gy without losing viability . This extreme radioresistance makes T. gammatolerans proteins, including SecF, valuable models for studying protein stability under harsh conditions. The organism thrives in temperatures between 55°C and 95°C with optimal growth at approximately 88°C and a pH of 6 , making its proteins ideal candidates for applications requiring thermostable components.

What is the SecF protein translocase subunit and what is its function in T. gammatolerans?

The SecF protein translocase subunit in T. gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) is a membrane protein component of the Sec protein translocation pathway. While the search results don't provide specific functional details for T. gammatolerans SecF, archaeal Sec systems generally function in the translocation of proteins across the cell membrane. The SecF subunit (gene name: secF, locus name: TGAM_0283) works in conjunction with other Sec components to form a channel through which proteins are transported . The amino acid sequence reveals characteristic transmembrane domains typical of membrane-embedded translocases, suggesting its role in protein secretion machinery adapted to extreme conditions.

How is recombinant T. gammatolerans SecF typically stored and handled in laboratory settings?

Recombinant T. gammatolerans SecF protein is typically stored in a Tris-based buffer with 50% glycerol to maintain stability . For long-term storage, it is recommended to keep the protein at -20°C, with extended storage at -80°C for maximum stability . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can compromise protein integrity . When handling this recombinant protein, researchers should consider its hyperthermophilic origin and assess activity at elevated temperatures that mimic its native conditions.

What expression systems are most effective for producing functional recombinant T. gammatolerans SecF protein?

Based on the available information and general approaches to archaeal protein expression, E. coli expression systems with modifications for hyperthermophilic proteins often provide good yields for T. gammatolerans proteins. When expressing SecF, researchers should consider using expression vectors with tags that facilitate purification while minimizing interference with the protein's membrane-associated properties.

Common challenges include:

  • Proper folding of membrane proteins in heterologous systems

  • Potential toxicity of overexpressed membrane proteins

  • Solubility issues with hydrophobic membrane proteins

A methodological approach involves:

  • Testing multiple expression strains (BL21(DE3), C41(DE3), C43(DE3))

  • Optimizing induction conditions (temperature, IPTG concentration)

  • Using specialized detergents for membrane protein extraction

  • Considering fusion tags that enhance solubility (MBP, SUMO)

What purification strategies yield the highest purity and activity for recombinant T. gammatolerans SecF?

Purification of recombinant T. gammatolerans SecF requires specialized approaches due to its membrane protein nature. While specific purification details aren't provided in the search results, general methodological approaches for similar archaeal membrane proteins include:

  • Mild detergent solubilization (n-dodecyl-β-D-maltoside or n-octyl-β-D-glucopyranoside)

  • Immobilized metal affinity chromatography (IMAC) using His-tags

  • Size exclusion chromatography for final polishing

  • Buffer optimization to maintain protein stability

A typical purification workflow might include:

  • Cell lysis by sonication or pressure-based methods

  • Membrane fraction isolation by differential centrifugation

  • Detergent-based membrane protein extraction

  • Sequential chromatography steps

Researchers should verify protein purity through SDS-PAGE and assess functional activity through specific translocase assays.

How can structural studies of T. gammatolerans SecF contribute to understanding protein translocation mechanisms in extremophiles?

Structural studies of T. gammatolerans SecF can provide valuable insights into adaptations of protein translocation machinery in extremophiles. Similar to studies conducted on T. gammatolerans PCNA , crystallographic analysis of SecF could reveal molecular features that contribute to thermostability and radiation resistance.

Methodological approaches include:

  • X-ray crystallography following crystallization screening

  • Cryo-electron microscopy for membrane protein complexes

  • Molecular dynamics simulations to understand flexibility under extreme conditions

  • Comparative structural analysis with mesophilic SecF proteins

Research findings might reveal:

  • Structural adaptations that confer thermostability (increased hydrophobic interactions, salt bridges)

  • Potential radiation-resistant protein features

  • Insights into membrane protein folding under extreme conditions

  • Structure-function relationships specific to archaeal protein translocation

What experimental approaches can be used to investigate the interaction between T. gammatolerans SecF and other components of the Sec translocation machinery?

Investigating protein-protein interactions within the T. gammatolerans Sec translocation machinery requires specialized approaches for membrane protein complexes. Advanced methodological strategies include:

  • Pull-down assays using tagged SecF to identify interaction partners

  • Cross-linking mass spectrometry to map interaction interfaces

  • Bacterial/archaeal two-hybrid systems adapted for membrane proteins

  • Reconstitution of partial or complete Sec machinery in proteoliposomes

Experimental setup typically involves:

  • Expression of multiple Sec pathway components

  • Affinity-based isolation of complexes

  • Functional assays measuring translocation activity

  • Structural characterization of sub-complexes

These approaches can reveal how SecF interfaces with SecD, SecY, and other components, providing insights into the archaeal protein translocation mechanism adapted to extreme environments.

What are the common challenges in maintaining recombinant T. gammatolerans SecF stability and how can they be addressed?

Membrane proteins like T. gammatolerans SecF present unique stability challenges. Based on storage recommendations and general knowledge of hyperthermophilic proteins, the following methodological approaches can enhance stability:

ChallengeSolution StrategyExperimental Approach
AggregationOptimize detergent type and concentrationScreen detergents (DDM, LDAO, CHAPS) at multiple concentrations
Proteolytic degradationAdd protease inhibitorsInclude PMSF, EDTA, or commercial protease inhibitor cocktails
Loss of activity during storageOptimize buffer componentsTest glycerol (25-50%), stabilizing salts, and reducing agents
Temperature sensitivityMatch native conditions during functional assaysConduct activity assays at elevated temperatures (55-88°C)

A systematic approach to stability optimization involves:

  • Buffer screening with varying pH, salt concentration, and additives

  • Storage condition testing (temperature, freeze-thaw impact)

  • Activity measurements after various storage periods

  • Analytical techniques (SEC, DLS) to monitor aggregation state

How can researchers differentiate between functional and non-functional forms of recombinant T. gammatolerans SecF in their preparations?

Assessing the functionality of recombinant T. gammatolerans SecF requires specialized assays that evaluate its role in protein translocation. While specific assays aren't detailed in the search results, methodological approaches include:

  • Reconstitution into proteoliposomes to measure translocation activity

  • ATPase activity assays when assembled with ATP-utilizing Sec components

  • Binding assays with known substrate proteins or peptides

  • Thermal shift assays to verify proper folding

Researchers might consider:

  • Comparing wild-type and mutant forms of SecF

  • Assessing activity across a temperature gradient (25-95°C)

  • Evaluating cooperation with other Sec system components

  • Developing reporter systems for translocation efficiency

How does T. gammatolerans SecF compare structurally and functionally to homologous proteins in other extremophiles?

Comparative analysis of T. gammatolerans SecF with homologs from other extremophiles can provide evolutionary insights into adaptation mechanisms. While specific comparisons aren't provided in the search results, methodological approaches include:

  • Multiple sequence alignment of SecF proteins across archaeal species

  • Phylogenetic analysis to trace evolutionary relationships

  • Homology modeling based on available structures

  • Comparison of conserved motifs and variable regions

Research findings might reveal patterns similar to those observed in Thermococcus species distribution studies , where both endemic populations and cosmopolitan distribution occur. Analysis of GC content at different codon positions can provide insights into gene history and evolutionary pressure .

What insights can be gained from studying the genomic context of the secF gene in T. gammatolerans compared to other archaea?

The genomic context analysis of secF (locus name: TGAM_0283) in T. gammatolerans can reveal evolutionary and functional relationships. Methodological approaches include:

  • Comparative genomic analysis across archaeal species

  • Assessment of gene synteny and operon organization

  • Identification of regulatory elements controlling secF expression

  • Analysis of horizontal gene transfer signatures

Researchers might investigate:

  • Whether secF is part of a conserved operon structure

  • Presence of co-expressed genes involved in protein translocation

  • Regulatory elements that respond to environmental stresses

  • Evidence of selection pressure on the secF gene

Such analysis can build upon approaches used in Thermococcus biogeographic studies , applying MLST (multilocus sequence typing) and other genomic comparison methods to understand the evolution of the Sec system in extremophiles.

How can T. gammatolerans SecF be engineered for enhanced functionality in biotechnological applications?

The extreme thermostability and radioresistance of T. gammatolerans proteins make SecF a candidate for protein engineering applications. Methodological approaches include:

  • Site-directed mutagenesis targeting functional domains

  • Domain swapping with homologous proteins

  • Rational design based on structural information

  • Directed evolution under selective pressure

Potential engineering goals might include:

  • Enhanced thermostability for industrial processes

  • Improved solubility while maintaining function

  • Modified substrate specificity for biotechnological applications

  • Creation of chimeric proteins with novel functions

The exceptional radiation resistance mechanisms of T. gammatolerans suggest potential applications in developing protein-based tools for environments with high radiation exposure.

What are the most promising research directions for applying T. gammatolerans protein translocation machinery in synthetic biology?

T. gammatolerans protein translocation machinery, including SecF, offers unique opportunities for synthetic biology applications due to its extremophilic properties. Promising research directions include:

  • Development of thermostable protein secretion systems for industrial biotechnology

  • Engineering radiation-resistant cellular machinery for specialized applications

  • Creation of minimal translocation systems for synthetic cells

  • Design of stress-resistant protein production platforms

Methodological approaches might include:

  • Reconstitution of simplified translocation systems

  • Integration of T. gammatolerans components into mesophilic host systems

  • Engineering orthogonal protein secretion pathways

  • Development of high-throughput screening systems to evaluate performance

The remarkable ability of T. gammatolerans to repair radiation-damaged DNA without loss of viability suggests potential applications in developing cellular systems with enhanced survival in extreme environments.

What statistical approaches are most appropriate for analyzing the kinetic properties of T. gammatolerans SecF in different experimental conditions?

When analyzing kinetic data for T. gammatolerans SecF, researchers should consider specialized statistical approaches that account for the unique properties of extremophilic proteins. Methodological recommendations include:

  • Nonlinear regression analysis for enzyme kinetics (Michaelis-Menten, if applicable)

  • Multiple comparison testing across temperature and pH ranges

  • Time-series analysis for stability studies

  • Principal component analysis for multivariate experimental conditions

Key considerations for experimental design:

  • Include appropriate temperature controls (25°C, 55°C, 88°C)

  • Test activity across pH ranges (especially near optimal pH 6)

  • Include technical and biological replicates

  • Use appropriate reference proteins for normalization

Data should be visualized using scatter plots with error bars, heat maps for temperature/pH optimization, and Arrhenius plots for temperature dependence of activity.

How can researchers accurately assess the impact of radiation exposure on T. gammatolerans SecF structure and function?

Given T. gammatolerans' extraordinary radiation resistance (up to 30,000 Gy) , assessing radiation effects on SecF requires specialized approaches. Methodological strategies include:

  • Controlled radiation exposure experiments at various doses

  • Structural analysis before and after radiation exposure

  • Functional assays measuring translocation activity post-irradiation

  • Analysis of radiation-induced chemical modifications

Experimental design considerations:

  • Use gamma radiation sources with precise dosimetry

  • Include positive controls (radiation-sensitive proteins)

  • Test recovery of activity over time post-irradiation

  • Analyze dose-response relationships

Statistical analysis might include survival curve modeling, comparison of EC50 values, and multivariate analysis to identify radiation-sensitive structural elements.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.