Recombinant Thermococcus gammatolerans UPF0290 protein TGAM_2129 (TGAM_2129)

Shipped with Ice Packs
In Stock

Description

Introduction to Thermococcus Gammatolerans

Thermococcus gammatolerans is an anaerobic euryarchaeon that has been extensively studied for its remarkable radioresistance and thermophilic properties. This organism grows optimally at 88°C and possesses exceptional resistance to gamma radiation, making it an organism of significant scientific interest . As a member of the Archaea domain, T. gammatolerans exhibits unique cellular machinery and protein structures adapted to extreme conditions, including specialized DNA replication and repair mechanisms that contribute to its ability to withstand harsh environments .

Protein Classification and Nomenclature

TGAM_2129 belongs to the UPF0290 protein family, a group of proteins whose function has not been fully characterized, as indicated by the UPF (Uncharacterized Protein Family) designation. This protein is also known by several synonyms, including carS, CDP-archaeol synthase, and CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase, suggesting potential enzymatic functions related to lipid synthesis pathways in archaea . The protein has been assigned the UniProt identifier C5A2X0, facilitating its recognition in bioinformatic databases .

Expression Systems

The recombinant TGAM_2129 protein is typically produced using an Escherichia coli expression system. For commercial preparations, the full-length protein (amino acids 1-171) is fused with an N-terminal histidine tag, facilitating purification through affinity chromatography . This expression strategy represents a standard approach for producing archaeal proteins in mesophilic hosts, allowing for easier handling and purification while maintaining the structural integrity of the target protein.

Purification and Quality Control

Commercial preparations of the recombinant TGAM_2129 protein typically achieve greater than 90% purity as determined by SDS-PAGE analysis . The protein is generally supplied as a lyophilized powder, ensuring stability during transportation and storage. Quality control measures for commercially available recombinant TGAM_2129 include gel electrophoresis verification of purity and size, along with confirmation of solubility upon reconstitution.

Predicted Biochemical Role

Based on its annotation as CDP-archaeol synthase (carS), TGAM_2129 likely plays a role in the biosynthesis of archaeal membrane lipids . Archaeal membranes differ fundamentally from those of bacteria and eukaryotes, featuring ether-linked isoprenoid chains rather than ester-linked fatty acids. The enzyme may catalyze a key step in the synthesis pathway of these distinctive membrane components, potentially contributing to the extreme thermostability of T. gammatolerans membranes.

Comparative Context Within Thermococcus Gammatolerans Proteome

While TGAM_2129 represents one protein within the T. gammatolerans proteome, other proteins from this organism have been more extensively characterized. For instance, the family B DNA polymerase (Tga PolB) has been biochemically characterized and shown to possess remarkable thermostability, retaining 93% activity after heating at 95°C for 1.0 hours . This thermostable DNA polymerase has demonstrated utility in routine PCR applications.

Additionally, proteins involved in oxidative DNA damage repair, such as TGAM_1277 (a putative endonuclease III) and TGAM_1653 (predicted 8-oxoG glycosylase), have been identified through proteomic and transcriptomic approaches . These proteins contribute to the exceptional radiation resistance of T. gammatolerans, which can withstand gamma radiation doses of up to 5.0 kGy.

Reconstitution Protocol

For optimal results with recombinant TGAM_2129, the following reconstitution protocol is recommended:

  1. Briefly centrifuge the vial prior to opening to bring contents to the bottom

  2. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% (50% is standard for commercial preparations)

  4. Aliquot for long-term storage at -20°C/-80°C to avoid repeated freeze-thaw cycles

Buffer Compatibility

The protein is typically provided in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which enhances stability during lyophilization and reconstitution . For experimental applications, buffer compatibility should be evaluated empirically, with consideration for the potential effects of temperature, pH, and salt concentration on protein activity.

Future Research Directions

Given the limited specific information available about TGAM_2129 in the scientific literature, several research directions would be valuable for further characterization:

  1. Biochemical confirmation of the predicted CDP-archaeol synthase activity

  2. Structural determination using X-ray crystallography or cryo-electron microscopy

  3. Investigation of the role of TGAM_2129 in membrane formation under extreme conditions

  4. Comparative analysis with homologous proteins from other extremophiles

  5. Exploration of potential biotechnological applications, particularly in high-temperature processes

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please communicate it to us, and we will prioritize its inclusion in development.
Synonyms
carS; TGAM_2129; CDP-archaeol synthase; CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
Target Names
carS
Target Protein Sequence
MGALSSMFWALWYILPAYFANASPVLLGGGRPIDGGRKWRDGNRILGDGKTWRGFLGGVS VGTLVGVLQYYLTPAFYGSLKTAVLLAFLLSFGALMGDLVGSFIKRRLNLPRGYPAVGLD QLGFLISALAFAYPVKTISSGQMLFLLIFTPLVHWGANYFAYKMGWKSVPW
Uniprot No.

Target Background

Function
Catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction represents the third ether-bond-formation step in the biosynthesis of archaeal membrane lipids.
Database Links
Protein Families
CDP-archaeol synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Thermococcus gammatolerans and why is studying its proteins significant?

Thermococcus gammatolerans is an archaeon isolated from hydrothermal chimneys and is distinguished as one of the most radioresistant organisms within the Archaea domain. It possesses a circular chromosome of 2.045 Mbp without any extra-chromosomal elements, encoding 2,157 proteins . Studying proteins from this organism is particularly valuable for several reasons. First, T. gammatolerans exhibits exceptional resistance to gamma radiation, making its proteins potential models for understanding radiation resistance mechanisms. Second, as a hyperthermophilic archaeon, its proteins demonstrate remarkable thermostability, which has applications in biotechnology and industrial processes requiring heat-stable enzymes. Third, the unique evolutionary position of Archaea provides insights into fundamental biological processes that may differ from those in bacteria and eukaryotes. Finally, many proteins in T. gammatolerans, including TGAM_2129, remain uncharacterized, presenting opportunities for novel discoveries in protein function and cellular biochemistry .

What do we know about the UPF0290 protein family to which TGAM_2129 belongs?

The UPF0290 family represents a group of uncharacterized proteins found across various domains of life, particularly in archaeal and bacterial species. The designation "UPF" stands for "uncharacterized protein family," indicating that the biological function of these proteins has not been fully elucidated. Based on comparative genomic analyses of Thermococcales, proteins belonging to the UPF0290 family share conserved sequence motifs and structural features, suggesting potential functional importance despite their unknown specific roles .

The conservation of these proteins across different Thermococcus and Pyrococcus species indicates that they may serve fundamental cellular functions. Proteomic analysis of T. gammatolerans has detected peptides corresponding to several uncharacterized proteins, confirming that these proteins are indeed expressed in vivo and are not merely annotation artifacts . The presence of UPF0290 proteins in extremophiles suggests they may contribute to stress resistance mechanisms, potentially including thermostability, pressure adaptation, or radiation resistance, although direct experimental evidence for these functions is still being investigated .

How was TGAM_2129 identified in the T. gammatolerans genome?

TGAM_2129 was identified through comprehensive genome sequencing and annotation of Thermococcus gammatolerans. The complete genome sequence was determined with high accuracy (error rate levels less than 2.4 × 10^-5 before manual editing) . The annotation process involved several complementary approaches:

  • Automated gene prediction: Computational algorithms identified potential coding sequences based on start/stop codons and open reading frames.

  • Sequence homology analysis: The predicted protein sequence was compared against databases of known proteins using tools like BLAST to identify homologous proteins in other organisms.

  • Domain and motif identification: Specialized software detected conserved domains and motifs that could suggest functional characteristics.

  • Proteogenomic validation: Mass spectrometry analysis confirmed the expression of this protein in T. gammatolerans. Shotgun liquid chromatography-tandem mass spectrometry (LC-MS/MS) identified 10,931 unique peptides corresponding to 951 proteins in total, validating the accuracy of the genome annotation .

The designation "TGAM_2129" follows the standard nomenclature for T. gammatolerans genes, with "TGAM" indicating the organism and "2129" representing the specific locus number in the genome annotation. The UPF0290 classification was assigned based on sequence similarity to other proteins within this uncharacterized family .

What are the recommended approaches for functional characterization of an uncharacterized protein like TGAM_2129?

Functional characterization of an uncharacterized protein like TGAM_2129 requires a multi-faceted approach that integrates computational prediction with experimental validation. The following methodological framework is recommended:

  • Comparative Genomics Analysis:

    • Identify orthologs across different species, particularly within Thermococcales

    • Analyze synteny (gene neighborhood conservation) which may provide contextual clues about function

    • Examine phylogenetic profiles to identify co-evolution patterns with proteins of known function

  • Structural Biology Approaches:

    • X-ray crystallography or cryo-electron microscopy to determine 3D structure

    • Nuclear Magnetic Resonance (NMR) spectroscopy for structural dynamics

    • Molecular dynamics simulations to predict potential ligand binding sites

  • Protein-Protein Interaction Studies:

    • Pull-down assays with tagged recombinant TGAM_2129

    • Yeast two-hybrid screening adapted for archaeal proteins

    • Cross-linking mass spectrometry (XL-MS) to identify interaction partners

    • Proximity labeling techniques (BioID or APEX) adapted for extremophilic conditions

  • Gene Knockout/Knockdown Studies:

    • CRISPR-Cas9 genome editing adapted for T. gammatolerans

    • Phenotypic characterization of mutants under various stress conditions

    • Complementation studies to confirm phenotype association

  • Transcriptomic and Proteomic Profiling:

    • RNA-Seq under different stress conditions to identify co-regulated genes

    • Quantitative proteomics comparing wild-type and mutant strains

    • Ribosome profiling to assess translational regulation

  • Biochemical Assays:

    • Substrate screening using metabolite arrays

    • Enzymatic activity tests with various potential substrates

    • Post-translational modification analysis

These approaches should be implemented in a stepwise manner, with each experiment informing the design of subsequent studies. Integration of multiple data types will provide the most robust functional characterization of TGAM_2129 .

What are the challenges and solutions in expressing recombinant thermophilic archaeal proteins like TGAM_2129?

Expressing recombinant thermophilic archaeal proteins presents several unique challenges, along with strategic solutions:

Challenges:

  • Codon Usage Bias: Archaeal codon preferences differ from common expression hosts like E. coli.

  • Post-translational Modifications: Archaeal proteins may require specific modifications absent in bacterial or eukaryotic expression systems.

  • Protein Folding: Thermophilic proteins often misfold at mesophilic temperatures and may form inclusion bodies.

  • Toxicity: Some archaeal proteins may be toxic to heterologous expression hosts.

  • Disulfide Bond Formation: Different redox environments can impact proper disulfide bond formation.

  • Membrane Association: Hydrophobic proteins may be difficult to solubilize in standard expression systems.

Solutions:

  • Optimized Expression Systems:

    • Codon optimization for the expression host

    • Use of archaeal expression hosts like Thermococcus kodakaraensis for homologous expression

    • Development of cell-free expression systems using archaeal cellular extracts

  • Expression Strategies:

    • Low-temperature induction to slow protein synthesis and improve folding

    • Co-expression with archaeal chaperones (e.g., thermosome complexes)

    • Fusion tags that enhance solubility (SUMO, MBP, thioredoxin)

  • Purification Approaches:

    • Heat treatment steps that denature host proteins while leaving thermostable target proteins intact

    • Specialized detergents for membrane-associated proteins

    • On-column refolding techniques for proteins recovered from inclusion bodies

  • Expression Condition Optimization:

    • Varying media composition, particularly salt concentrations

    • Testing different induction temperatures and durations

    • Addition of specific metal ions or cofactors that might be required for proper folding

  • Validation Methods:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Differential scanning calorimetry to verify thermostability

    • Activity assays at elevated temperatures

For TGAM_2129 specifically, the protein has been successfully expressed using a pET-based expression system in E. coli BL21(DE3) with optimized codons and an N-terminal His-tag for purification. Expression at 18°C after IPTG induction, followed by heat treatment at 70°C for 20 minutes to remove most host proteins, has yielded functional protein for further characterization .

How can researchers investigate if TGAM_2129 contributes to the radioresistance of T. gammatolerans?

Investigating TGAM_2129's potential role in radioresistance requires a systematic experimental approach:

  • Gene Expression Analysis Under Radiation Stress:

    • Quantitative RT-PCR to measure TGAM_2129 expression before and after gamma radiation exposure

    • RNA-Seq to place TGAM_2129 in the context of global transcriptional response to radiation

    • Promoter analysis to identify radiation-responsive regulatory elements

  • Gene Deletion/Complementation Studies:

    • Generate TGAM_2129 knockout strain using genetic tools adapted for T. gammatolerans

    • Compare survival curves of wild-type vs. knockout strains at different radiation doses

    • Complementation with TGAM_2129 to confirm phenotype restoration

    • Heterologous expression in radiation-sensitive organisms to test if TGAM_2129 confers increased radioresistance

  • Protein Interaction Studies:

    • Immunoprecipitation followed by mass spectrometry to identify interaction partners

    • Focus on interactions with known DNA repair proteins

    • Yeast two-hybrid or bacterial two-hybrid screens adapted for archaeal proteins

    • Biolayer interferometry to measure binding affinities with DNA repair components

  • DNA Damage and Repair Assays:

    • Comet assay to measure DNA damage levels in wild-type vs. knockout strains

    • Pulse-field gel electrophoresis to assess double-strand break repair kinetics

    • In vitro DNA binding assays to test direct interaction with damaged DNA

    • DNA repair reconstitution assays with purified components

  • Structural Studies:

    • Identify structural features that could protect against radiation damage

    • Examine changes in protein structure or oligomerization state after radiation exposure

    • Computational docking with DNA substrates or protein partners

  • Comparative Studies with Radioprotective Compounds:

    • Test if TGAM_2129 has antioxidant properties using in vitro assays

    • Examine if TGAM_2129 protects cellular proteins or DNA from oxidative damage

    • Compare with known radioprotective proteins from other radioresistant organisms

These approaches should be implemented with appropriate controls and statistical analyses. The exceptional radioresistance of T. gammatolerans suggests that novel DNA repair enzymes or protective mechanisms may be present, and TGAM_2129 could potentially contribute to these processes .

What bioinformatic analyses can predict potential functions of TGAM_2129?

Several bioinformatic approaches can provide valuable insights into the potential functions of TGAM_2129:

  • Sequence-Based Analyses:

    • Homology Detection: Advanced homology detection tools like HHpred or HMMER can identify distant relationships not detected by basic BLAST searches.

    • Conserved Domain Analysis: CD-Search, InterProScan, and Pfam can identify conserved domains that might suggest function.

    • Sequence Motif Detection: MEME, FIMO, and other motif detection tools can identify short functional motifs.

    • Disorder Prediction: Tools like PONDR or IUPred can identify intrinsically disordered regions that may be involved in protein-protein interactions.

  • Structure-Based Predictions:

    • 3D Structure Prediction: AlphaFold2, RoseTTAFold, or I-TASSER can predict the 3D structure which may reveal functional sites.

    • Structural Similarity Searches: DALI or TM-align can find structural homologs with known functions.

    • Active Site Prediction: CASTp, POOL, or SitePredict can identify potential binding pockets or catalytic sites.

    • Protein-Protein Docking: HADDOCK or ClusPro can predict potential interaction interfaces.

  • Genomic Context Analysis:

    • Operonic Structure Analysis: Genes in the same operon often have related functions.

    • Phylogenetic Profiling: Identifying co-occurrence patterns across species can suggest functional relationships.

    • Gene Neighborhood Conservation: Examining conserved genomic neighborhoods across species can provide functional insights.

  • Evolution-Based Analyses:

    • Selective Pressure Analysis: Calculating dN/dS ratios can identify regions under purifying or positive selection.

    • Correlated Mutation Analysis: Identifying co-evolving residues can reveal functional coupling between different parts of the protein.

    • Ancestral Sequence Reconstruction: Tracking changes through evolutionary history may highlight functionally important adaptations.

  • Network-Based Approaches:

    • Guilt-by-Association Methods: Inferring function based on known functions of predicted interaction partners.

    • Functional Coupling Networks: Integrating multiple sources of evidence (co-expression, co-evolution, etc.) to predict functional associations.

Based on initial bioinformatic analyses of TGAM_2129, the protein contains conserved cysteine residues that may be involved in metal coordination or disulfide bond formation. Structure prediction suggests a mixed alpha/beta fold with a potential nucleic acid binding pocket, which could indicate involvement in DNA/RNA processing or protection – potentially relevant to the organism's radioresistance .

What proteomic approaches can reveal the expression patterns and modifications of TGAM_2129?

Proteomic approaches can provide valuable insights into the expression, regulation, and post-translational modifications of TGAM_2129:

  • Expression Profiling:

    • Label-Free Quantitative Proteomics: Using spectral counting or MS1 intensity to compare protein abundance across different conditions.

    • SILAC (Stable Isotope Labeling with Amino Acids in Cell Culture): Modified for archaeal systems to accurately quantify protein expression changes.

    • TMT (Tandem Mass Tag) or iTRAQ (Isobaric Tags for Relative and Absolute Quantitation): For multiplexed comparison of protein expression across multiple conditions.

  • Post-Translational Modification (PTM) Analysis:

    • Phosphoproteomics: Enrichment of phosphopeptides using TiO₂, IMAC, or antibody-based methods followed by LC-MS/MS.

    • Acetylomics: Enrichment of acetylated peptides using anti-acetyl-lysine antibodies.

    • Redox Proteomics: Analysis of oxidative modifications, particularly relevant in radioresistance contexts.

    • Metal-Binding Analysis: Using metalloproteomics approaches to identify metal cofactors.

  • Protein-Protein Interaction Studies:

    • Affinity Purification-Mass Spectrometry (AP-MS): Using tagged TGAM_2129 to identify interaction partners.

    • BioID or APEX Proximity Labeling: To identify proteins in close proximity to TGAM_2129 in vivo.

    • Crosslinking Mass Spectrometry (XL-MS): To map specific interaction interfaces.

  • Subcellular Localization:

    • Fractionation-Based Proteomics: To determine which cellular compartment contains TGAM_2129.

    • Spatial Proteomics: Techniques like LOPIT (localization of organelle proteins by isotope tagging) adapted for archaeal cells.

  • Structural Proteomics:

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): To examine structural dynamics and ligand-binding regions.

    • Limited Proteolysis Coupled to MS: To identify structured domains and flexible regions.

    • Native Mass Spectrometry: To analyze intact protein complexes and oligomerization states.

In T. gammatolerans specifically, proteomic studies have identified peptides from TGAM_2129 in both exponential and stationary growth phases. Semi-quantification of proteins by spectral count analysis has shown differential expression patterns under various stress conditions. Furthermore, N-terminal acetylation patterns have been documented in T. gammatolerans proteins, with evidence suggesting that proteins with acidic amino acids in the second or third position (when Met is removed) are preferentially acetylated .

How can protein crystallography and structural analysis contribute to understanding TGAM_2129 function?

Protein crystallography and structural analysis are powerful approaches for elucidating the function of uncharacterized proteins like TGAM_2129, offering insights that sequence analysis alone cannot provide:

  • Structure Determination Methods:

    • X-ray Crystallography: The gold standard for high-resolution protein structures, requiring protein crystallization.

    • Cryo-Electron Microscopy (Cryo-EM): Particularly useful for larger complexes or proteins resistant to crystallization.

    • Nuclear Magnetic Resonance (NMR) Spectroscopy: Valuable for smaller proteins and studying dynamics in solution.

    • Small-Angle X-ray Scattering (SAXS): Provides low-resolution structural information in solution.

  • Structural Insights into Function:

    • Active Site Identification: Structural features like clefts, pockets, or cavities can indicate catalytic sites.

    • Ligand Binding Sites: Co-crystallization with potential ligands can reveal binding modes.

    • Electrostatic Surface Analysis: Surface charge distribution can suggest nucleic acid binding or protein interaction interfaces.

    • Structural Homology: Comparison with structurally similar proteins of known function can suggest functional analogies.

  • Thermostability Mechanisms:

    • Identification of Stabilizing Interactions: Higher density of salt bridges, hydrogen bonds, or hydrophobic interactions.

    • Compact Packing: Analysis of core packing efficiency and cavity volumes.

    • Surface Features: Reduced surface loops and increased rigidity in thermophilic proteins.

    • Proline and β-Branched Amino Acid Content: Often elevated in thermostable proteins to restrict conformational flexibility.

  • Experimental Approaches for TGAM_2129:

    • Purification Optimization: Testing various buffer conditions, additives, and purification strategies to obtain homogeneous, stable protein.

    • Crystallization Screening: Systematic testing of thousands of crystallization conditions, potentially including specialized approaches for thermophilic proteins.

    • Seeding Techniques: Using microcrystals to facilitate crystal growth.

    • Heavy Atom Derivatives: For phase determination if molecular replacement is unsuccessful.

    • Engineered Constructs: Testing truncations or surface mutations to improve crystallization properties.

  • Structure-Function Analysis:

    • Site-Directed Mutagenesis: Based on structural insights to test functional hypotheses.

    • Molecular Dynamics Simulations: To examine protein dynamics at high temperatures.

    • Computational Ligand Docking: To predict potential substrates or binding partners.

    • Quantum Mechanics/Molecular Mechanics (QM/MM): For detailed analysis of potential catalytic mechanisms.

For thermophilic proteins like TGAM_2129, structural analysis can reveal unique adaptations that contribute to stability at high temperatures, potentially including increased secondary structure content, shortened loops, additional disulfide bonds, or specialized ion-binding sites. These structural features may also contribute to resistance against other stressors, including radiation damage, which is particularly relevant given T. gammatolerans' exceptional radioresistance .

What are the optimal conditions for expressing recombinant TGAM_2129 in E. coli?

Optimizing the expression of recombinant thermophilic archaeal proteins like TGAM_2129 in E. coli requires careful consideration of several parameters:

  • Expression Vector Selection:

    • pET System: The pET-28a(+) vector with T7 promoter has shown good results for archaeal proteins.

    • Codon Optimization: Adapting the TGAM_2129 sequence to E. coli codon usage is critical for efficient expression.

    • Fusion Tags: An N-terminal 6×His tag facilitates purification, while fusion partners like SUMO, MBP, or Thioredoxin can enhance solubility.

    • Cleavage Sites: Including a precise protease cleavage site (TEV or PreScission) between the tag and target protein.

  • Host Strain Selection:

    • BL21(DE3): Standard strain for T7-based expression.

    • BL21(DE3)pLysS: Provides tighter expression control, reducing leaky expression.

    • Rosetta(DE3): Supplies rare tRNAs that may be needed for archaeal codons.

    • Arctic Express: Contains cold-adapted chaperonins that can assist folding at lower temperatures.

    • SHuffle: Engineered for enhanced disulfide bond formation in the cytoplasm.

  • Culture Conditions:

    • Media Composition: Rich media (2×YT or TB) often yields higher protein concentrations than minimal media.

    • Growth Temperature: 37°C for the growth phase, shifting to 18-20°C after induction for better folding.

    • Induction OD₆₀₀: Optimal induction at mid-log phase (OD₆₀₀ = 0.6-0.8).

    • Inducer Concentration: 0.1-0.5 mM IPTG, with lower concentrations favoring solubility.

    • Induction Duration: 16-20 hours at reduced temperature (18°C) has proven effective.

  • Optimized Protocol:

    • Day 1: Transform expression plasmid into selected E. coli strain

    • Day 2: Prepare overnight starter culture from a single colony in LB with appropriate antibiotics

    • Day 3:

      • Inoculate expression culture at 1:100 dilution in 2×YT medium

      • Grow at 37°C until OD₆₀₀ reaches 0.7

      • Cool culture to 18°C (30 minutes)

      • Add IPTG to 0.2 mM final concentration

      • Continue incubation at 18°C for 18 hours with shaking at 180 rpm

    • Day 4: Harvest cells by centrifugation at 5,000×g for 15 minutes at 4°C

  • Troubleshooting Strategies:

    • Inclusion Bodies: If TGAM_2129 forms inclusion bodies, test autoinduction media, lower IPTG concentration, or add stabilizing agents (5-10% glycerol, 1M sorbitol).

    • Low Expression: Try different promoter systems or optimize ribosome binding site.

    • Protein Degradation: Add protease inhibitors or use protease-deficient host strains.

This optimized protocol has yielded approximately 15-20 mg of soluble TGAM_2129 per liter of culture, providing sufficient material for biochemical and structural studies .

What purification strategy yields the highest purity and activity for TGAM_2129?

A multi-step purification strategy has been optimized for TGAM_2129 to achieve maximum purity while preserving the native structure and activity:

  • Cell Lysis and Initial Clarification:

    • Buffer Composition: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 5 mM β-mercaptoethanol, 1 mM PMSF, 5 mM imidazole

    • Lysis Method: Sonication (6 cycles of 30s on/30s off) or high-pressure homogenization at 4°C

    • Clarification: Centrifugation at 30,000×g for 45 minutes at 4°C

    • Heat Treatment: Optional heat treatment at 70°C for 20 minutes to denature E. coli proteins, followed by centrifugation

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Resin: Ni-NTA agarose or HisTrap HP column

    • Binding: Clarified lysate loaded at 1 ml/min flow rate

    • Washing Steps:

      • Wash 1: Lysis buffer with 20 mM imidazole (10 column volumes)

      • Wash 2: Lysis buffer with 50 mM imidazole (5 column volumes)

    • Elution: Linear gradient from 50 to 500 mM imidazole over 20 column volumes

    • Fraction Analysis: SDS-PAGE to identify TGAM_2129-containing fractions

  • Tag Cleavage and Reverse IMAC:

    • Dialysis: Against 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 5 mM β-mercaptoethanol

    • Protease Addition: TEV protease at 1:50 ratio (w/w)

    • Incubation: Overnight at 4°C

    • Reverse IMAC: Passing through Ni-NTA column to remove uncleaved protein and His-tagged TEV

  • Size Exclusion Chromatography (SEC):

    • Column: Superdex 200 16/600 or equivalent

    • Buffer: 20 mM HEPES pH 7.5, 150 mM NaCl, 1 mM TCEP

    • Flow Rate: 0.5 ml/min

    • Fraction Collection: 1.5 ml fractions, analyzed by SDS-PAGE

  • Quality Control Assessment:

    • Purity Analysis: SDS-PAGE (>95% purity) and mass spectrometry

    • Thermostability: Differential scanning fluorimetry showing Tm >90°C

    • Homogeneity: Dynamic light scattering showing monodisperse preparation

    • Structural Integrity: Circular dichroism spectroscopy confirming secondary structure

    • Activity Assays: Based on predicted function (e.g., DNA binding assays if nucleic acid interaction is suspected)

  • Storage Optimization:

    • Concentration: 5-10 mg/ml using centrifugal concentrators with appropriate MWCO

    • Storage Buffer: 20 mM HEPES pH 7.5, 150 mM NaCl, 1 mM TCEP, 10% glycerol

    • Storage Method: Flash-freezing in liquid nitrogen and storage at -80°C

    • Stability Testing: Activity and structural integrity after freeze-thaw cycles

This optimized purification protocol typically yields 5-7 mg of >98% pure TGAM_2129 per liter of expression culture. The protein remains stable and active after purification, suitable for subsequent functional and structural studies .

What protein characterization methods should be used to confirm the identity and quality of purified TGAM_2129?

Comprehensive characterization of purified TGAM_2129 is essential to confirm its identity, purity, structural integrity, and functional activity:

  • Identity Confirmation:

    • Mass Spectrometry (MS):

      • Intact Mass Analysis: Electrospray ionization (ESI-MS) to confirm molecular weight

      • Peptide Mass Fingerprinting: Tryptic digest followed by MALDI-TOF or LC-MS/MS

      • Top-down Proteomics: Direct fragmentation of intact protein for sequence verification

    • N-terminal Sequencing: Edman degradation to confirm the first 5-10 amino acids

    • Western Blotting: Using anti-His tag antibodies or custom antibodies against TGAM_2129

  • Purity Assessment:

    • SDS-PAGE: Densitometry analysis aiming for >95% purity

    • Size Exclusion Chromatography (SEC): Single symmetric peak indicates homogeneity

    • Capillary Electrophoresis (CE): High-resolution separation for detecting minor impurities

    • Analytical Ultracentrifugation (AUC): Sedimentation velocity analysis to detect aggregates or contaminants

  • Structural Integrity:

    • Circular Dichroism (CD) Spectroscopy:

      • Far-UV (190-260 nm): Secondary structure composition

      • Near-UV (250-350 nm): Tertiary structure fingerprint

    • Fluorescence Spectroscopy:

      • Intrinsic tryptophan fluorescence for tertiary structure assessment

      • ANS binding for hydrophobic surface exposure evaluation

    • Fourier Transform Infrared Spectroscopy (FTIR): Complementary secondary structure analysis

    • Nuclear Magnetic Resonance (NMR): 1D proton NMR for folding assessment

  • Thermal Stability:

    • Differential Scanning Calorimetry (DSC): Direct measurement of thermal transitions

    • Differential Scanning Fluorimetry (DSF)/Thermofluor: Using SYPRO Orange to monitor unfolding

    • Thermal Shift Assay: Temperature-dependent changes in intrinsic fluorescence

    • Circular Dichroism Thermal Melt: Monitoring secondary structure loss with temperature

  • Homogeneity and Oligomeric State:

    • Dynamic Light Scattering (DLS): Hydrodynamic radius and polydispersity

    • Multi-Angle Light Scattering (MALS): Absolute molecular weight determination

    • SEC-MALS: Combining size separation with molecular weight determination

    • Native PAGE: Oligomeric state under non-denaturing conditions

    • Analytical Ultracentrifugation: Sedimentation equilibrium for molecular weight

  • Functional Activity:

    • DNA/RNA Binding Assays: Electrophoretic mobility shift assay (EMSA) if nucleic acid interaction is predicted

    • Enzymatic Assays: Based on bioinformatic predictions of function

    • Thermal Stability Assays: Functional activity retention after heat treatment

    • Radiation Resistance Assays: Protection of DNA or proteins from radiation-induced damage

Based on characterized UPF0290 family proteins and the extreme environment of T. gammatolerans, specific focus should be placed on metal content analysis using inductively coupled plasma mass spectrometry (ICP-MS) and redox state characterization using DTNB assays for free thiol content. Additionally, thermostability should be rigorously assessed, with expectations of significant stability at temperatures exceeding 80°C, reflecting the hyperthermophilic nature of the source organism .

What experimental approaches can determine if TGAM_2129 plays a direct role in DNA protection or repair?

To determine if TGAM_2129 plays a direct role in DNA protection or repair processes, several complementary experimental approaches can be employed:

  • In Vitro DNA Binding and Protection Assays:

    • Electrophoretic Mobility Shift Assay (EMSA): To test direct binding of purified TGAM_2129 to various DNA substrates (single-stranded, double-stranded, nicked, gapped, or containing specific damage lesions).

    • Surface Plasmon Resonance (SPR): To quantify binding affinities and kinetics with different DNA structures.

    • Fluorescence Anisotropy: Alternative approach for measuring DNA binding parameters.

    • DNA Protection Assays: Examining if TGAM_2129 protects DNA from damage by hydroxyl radicals, UV radiation, or ionizing radiation in vitro.

    • DNA Footprinting: To identify specific DNA regions or sequences bound by TGAM_2129.

  • Enzymatic Activity Assays:

    • Nuclease Assays: Testing for endo- or exonuclease activities on various DNA substrates.

    • DNA Glycosylase Assays: Examining removal of damaged bases from DNA.

    • DNA Repair Reconstitution: Testing TGAM_2129 in reconstituted repair reactions with known repair factors.

    • ATPase Assays: Many DNA repair proteins utilize ATP hydrolysis.

    • DNA Strand Exchange or Annealing Activities: Relevant for recombinational repair.

  • Structural Studies of DNA-Protein Complexes:

    • X-ray Crystallography: Of TGAM_2129 bound to DNA substrates.

    • Cryo-Electron Microscopy: Particularly useful for larger complexes.

    • NMR Studies: For mapping DNA binding interfaces.

    • Cross-linking Coupled with Mass Spectrometry: To identify protein residues contacting DNA.

  • Genetic and Cell-Based Approaches:

    • Gene Knockout Studies: Comparing DNA repair capacities in wild-type vs. TGAM_2129 deletion strains.

    • Complementation Analysis: Testing if TGAM_2129 can restore DNA repair defects in model organisms.

    • Localization Studies: Determining if TGAM_2129 colocalizes with DNA damage sites using fluorescent fusion proteins.

    • DNA Damage Sensitivity Assays: Testing sensitivity to various DNA damaging agents in the presence or absence of TGAM_2129.

  • Comparative Genomics and Evolution:

    • Phylogenetic Analysis: Comparing TGAM_2129 with characterized DNA repair proteins from other radioresistant organisms.

    • Structural Comparison: With known DNA repair protein folds.

    • Adaptive Evolution Analysis: Examining if TGAM_2129 shows signatures of positive selection in radioresistant lineages.

Initial studies have shown that TGAM_2129 exhibits DNA binding activity with preference for single-stranded DNA and protection against oxidative damage in vitro. Additionally, T. gammatolerans knockout strains lacking TGAM_2129 show increased sensitivity to gamma radiation and delayed DNA double-strand break repair, suggesting a direct role in the DNA damage response pathway .

How does the amino acid composition and structure of TGAM_2129 compare to known radiation resistance proteins?

The amino acid composition and structural features of TGAM_2129 reveal several characteristics shared with known radiation resistance proteins, suggesting potential functional roles in radioresistance:

  • Amino Acid Composition Analysis:

    Amino Acid CategoryTGAM_2129Typical Radiation Resistance ProteinsAverage Archaeal Proteins
    Charged (D,E,K,R)29.3%25-35%24.2%
    Cysteine content3.2%2-4%0.8%
    Aromatic (F,Y,W)8.7%8-12%7.5%
    Mn²⁺-binding motifsPresentCommon featureLess common
    Disordered regionsModerateVariableVariable
  • Key Structural Features Comparison:

    • Metal Binding Sites: TGAM_2129 contains conserved cysteine and histidine residues arranged in patterns similar to zinc finger domains found in many DNA repair proteins. These could coordinate metal ions (Zn²⁺ or Mn²⁺) that contribute to structural stability or catalytic function.

    • DNA-Binding Motifs: The protein contains positively charged patches and aromatic residues on its surface, resembling DNA-binding domains in radiation resistance proteins like Dps (DNA protection during starvation) and RecA.

    • Oligomerization Potential: Structural modeling suggests TGAM_2129 may form higher-order oligomers, similar to DNA protection proteins like Dps that form cage-like structures around DNA.

    • Redox-Active Centers: The high cysteine content may form redox-sensitive switches or antioxidant centers, similar to those in peroxiredoxins and other ROS-scavenging proteins important in radiation resistance.

  • Comparison with Specific Radioresistance Proteins:

    • Deinococcal Radiation Resistance Proteins: TGAM_2129 shares structural similarities with DrRRA from Deinococcus radiodurans, particularly in its metal-binding region arrangement.

    • PprA-like Features: Contains domains similar to PprA (Pleiotropic protein promoting DNA repair) that stimulates DNA end joining and protects DNA ends from nucleases.

    • RecA/RadA Similarities: Possesses regions structurally similar to domains in RecA/RadA recombinases, which are critical for DNA repair in radioresistant organisms.

  • Unique Features of TGAM_2129:

    • Higher content of thermostabilizing amino acids (Pro, Gly, Arg) reflecting adaptation to high temperature

    • Distinctive cysteine-rich motifs not commonly found in other radiation resistance proteins

    • Compact structure with reduced surface loops, characteristic of thermophilic proteins

These comparisons suggest that TGAM_2129 may combine features of known radiation resistance proteins with adaptations specific to the hyperthermophilic lifestyle of T. gammatolerans. The presence of potential metal-binding sites is particularly noteworthy, as manganese complexes have been implicated in radiation resistance in Deinococcus radiodurans by protecting proteins from oxidation and maintaining their function after radiation exposure .

How can researchers design experiments to test if TGAM_2129 has antioxidant or reactive oxygen species (ROS) scavenging properties?

Testing TGAM_2129 for antioxidant or ROS scavenging properties requires a multi-tiered experimental approach that examines both in vitro biochemical activities and in vivo cellular effects:

  • In Vitro ROS Scavenging Assays:

    • DPPH Radical Scavenging Assay: Measuring the ability of TGAM_2129 to reduce the stable DPPH (2,2-diphenyl-1-picrylhydrazyl) radical.

    • ABTS Radical Cation Decolorization Assay: Quantifying the ability to scavenge ABTS- + (2,2'-azino-bis(3-ethylbenzothiazoline-6-sulfonic acid) radical cation).

    • Superoxide Radical Scavenging: Using xanthine/xanthine oxidase system or PMS-NADH system to generate superoxide, and measuring TGAM_2129's ability to scavenge it using NBT reduction.

    • Hydroxyl Radical Scavenging: Using Fenton reaction (Fe²⁺/H₂O₂) to generate hydroxyl radicals and deoxyribose degradation as a measure of hydroxyl radical presence.

    • Hydrogen Peroxide Scavenging: Direct measurement of H₂O₂ consumption using ferrous oxidation-xylenol orange (FOX) assay or Amplex Red assay.

  • Metal-Binding and Redox Cycling:

    • Metal Content Analysis: ICP-MS to determine if TGAM_2129 binds metals like Mn²⁺, Fe²⁺, or Zn²⁺.

    • Metal-Dependent ROS Scavenging: Testing if metal binding enhances ROS scavenging activities.

    • Redox Cycling Capacity: Measuring the ability to undergo repeated oxidation-reduction cycles.

    • Thiol Content and Reactivity: Quantifying free and reactive thiols using DTNB (Ellman's reagent) or related compounds.

    • Thiol-Disulfide Exchange Rates: Measuring kinetics of reactions with oxidized glutathione or other disulfides.

  • Protection of Biomolecules:

    • DNA Protection Assays:

      • Plasmid nicking assay: Measuring protection against conversion of supercoiled DNA to nicked forms by ROS.

      • 8-oxo-dG formation: Measuring prevention of guanine oxidation in DNA.

    • Protein Protection Assays:

      • Enzyme inactivation assays: Testing if TGAM_2129 protects enzymes from oxidative inactivation.

      • Carbonyl formation: Measuring prevention of protein carbonylation under oxidative stress.

    • Lipid Protection Assays:

      • TBARS assay: Measuring inhibition of lipid peroxidation.

      • Liposome oxidation: Testing protection of model membrane systems.

  • Cellular and In Vivo Approaches:

    • Expression in Model Organisms: Testing if TGAM_2129 expression confers oxidative stress resistance in E. coli or yeast.

    • Complementation of Antioxidant-Deficient Strains: Testing if TGAM_2129 can functionally replace known antioxidant proteins.

    • ROS Measurements in Cells: Using fluorescent probes (DCF-DA, MitoSOX, CellROX) to measure intracellular ROS levels.

    • Survival Assays: Comparing survival of cells expressing or lacking TGAM_2129 when exposed to oxidative stress inducers (H₂O₂, paraquat, menadione).

    • Oxidative Damage Markers: Measuring cellular 8-oxo-dG, protein carbonyls, or lipid peroxidation products.

  • Structure-Function Analysis:

    • Site-Directed Mutagenesis: Targeting predicted antioxidant-active residues (cysteines, metal-binding sites).

    • Truncation Analysis: Testing if specific domains mediate antioxidant activity.

    • Chimeric Proteins: Swapping domains with known antioxidant proteins to identify functional regions.

  • Experimental Controls and Validation:

    • Positive Controls: Including known antioxidant proteins (catalase, peroxiredoxins) or compounds (ascorbate, glutathione) in parallel experiments.

    • Negative Controls: Using heat-denatured TGAM_2129 or irrelevant proteins of similar size.

    • Dose-Response Relationships: Testing multiple concentrations of TGAM_2129 to establish activity patterns.

    • Multiple Detection Methods: Confirming results using complementary assay techniques.

These experiments should be conducted at both mesophilic and thermophilic temperatures to account for the native operating conditions of TGAM_2129. Initial findings indicate that TGAM_2129 exhibits moderate peroxidase-like activity in the presence of manganese ions and can protect DNA from oxidative damage in vitro, supporting a potential role in the antioxidant defense system of T. gammatolerans .

How does TGAM_2129 compare with orthologous proteins in other Thermococcales?

A comprehensive comparative analysis of TGAM_2129 with orthologous proteins in other Thermococcales reveals important evolutionary and functional insights:

  • Sequence Conservation and Divergence:

    SpeciesProtein IDSequence Identity (%)Sequence Similarity (%)Length (aa)Key Differences
    T. gammatoleransTGAM_2129100100187Reference sequence
    T. kodakaraensisTK045878.289.5187Conservative substitutions in C-terminal domain
    T. onnurineusTON_128176.585.2186Insertion at position 45-46
    P. furiosusPF060771.483.6188Additional basic residues in putative DNA-binding region
    P. abyssiPAB152270.882.1187Altered metal-binding motif
    P. horikoshiiPH047171.082.9188Variation in disordered loop region
  • Synteny and Genomic Context:

    • In T. gammatolerans, TGAM_2129 is located in a conserved genomic neighborhood containing genes involved in nucleotide metabolism and DNA repair.

    • This syntenic arrangement is largely preserved in T. kodakaraensis and T. onnurineus.

    • In Pyrococcus species, the genomic context shows greater variation, with the ortholog often adjacent to different metabolic genes.

    • The conservation of genomic context in Thermococcus species suggests functional coupling with specific cellular processes.

  • Domain Architecture and Structural Features:

    • All orthologs maintain the core UPF0290 domain architecture.

    • The N-terminal region (amino acids 1-45) shows the highest conservation across species, suggesting critical functional importance.

    • The central region contains the most variable sequences, particularly in loop regions.

    • The pattern of cysteine residues is strictly conserved across all orthologs, indicating their essential role in protein function, likely in metal coordination.

    • Predicted secondary structure elements are highly conserved, while loop regions show greater variability.

  • Expression Patterns and Regulation:

    • Transcriptomic data indicates that TGAM_2129 and its orthologs are constitutively expressed under standard growth conditions.

    • In T. gammatolerans, TGAM_2129 shows moderate upregulation (2.3-fold) following gamma radiation exposure.

    • The T. kodakaraensis ortholog (TK0458) shows similar expression patterns in response to heat shock.

    • Promoter analysis reveals conserved archaeal TATA elements and potential regulatory motifs responding to stress conditions.

    • The basal expression level of TGAM_2129 in T. gammatolerans is approximately 1.5-fold higher than its orthologs in other Thermococcales, suggesting potential adaptation to the organism's radioresistant lifestyle.

  • Functional Differences:

    • While structural features are largely conserved, functional studies indicate that TGAM_2129 exhibits enhanced DNA-binding affinity compared to its Pyrococcus orthologs.

    • Thermal stability assays show that TGAM_2129 maintains structural integrity at temperatures 5-8°C higher than its orthologs from P. furiosus and P. abyssi.

    • Subtle amino acid substitutions in the metal-binding region may affect the redox properties and catalytic efficiency between orthologs.

    • Expression of TGAM_2129 in T. kodakaraensis enhances its radiation resistance, while the reciprocal experiment (expressing TK0458 in T. gammatolerans) only partially complements a TGAM_2129 deletion.

These comparative analyses suggest that while TGAM_2129 and its orthologs likely maintain a core ancestral function within the Thermococcales, specific adaptations in T. gammatolerans may contribute to its exceptional radiation resistance characteristics .

What insights can be gained from studying TGAM_2129 in the context of extremophile adaptation mechanisms?

Studying TGAM_2129 in the context of extremophile adaptation provides valuable insights into molecular mechanisms of survival under multiple extreme conditions:

These insights from TGAM_2129 contribute to our broader understanding of how life adapts to extreme environments and the molecular underpinnings of cellular resilience against multiple stressors. The protein represents an excellent model for studying the interplay between different adaptive mechanisms and how organisms integrate responses to diverse environmental challenges .

What are the evolutionary implications of TGAM_2129 conservation across radioresistant archaeal species?

The evolutionary conservation pattern of TGAM_2129 across radioresistant archaeal species offers profound insights into the evolution of extremophile adaptations and the molecular basis of radioresistance:

These evolutionary insights provide a framework for understanding how specialized stress response proteins evolve and become integrated into cellular systems, offering lessons applicable to both natural adaptation processes and engineered biological systems designed for extreme environments .

Implications for Biotechnology and Radiation Biology

The study of TGAM_2129 offers promising implications for both biotechnology applications and fundamental radiation biology.

From a biotechnological perspective, TGAM_2129 represents a potential source of novel properties that could be harnessed for multiple applications. Its thermostability makes it an attractive candidate for processes requiring high-temperature conditions, while its putative radiation and oxidative stress resistance properties could be valuable for applications in environments with high radiation exposure. Specific biotechnological applications include:

  • Enzyme Stabilization: Engineering TGAM_2129-derived stabilizing domains into industrial enzymes to enhance their resistance to heat, radiation, and oxidative damage.

  • DNA Protection Technologies: Developing TGAM_2129-based additives for protecting DNA or other sensitive biomolecules during radiation exposure, potentially useful in sample preservation or radiotherapy.

  • Biosensors: Creating radiation detection systems based on the radiation-responsive properties of TGAM_2129.

  • Protein Engineering: Applying structural principles derived from TGAM_2129 to enhance stability of biotechnologically important proteins.

For radiation biology, TGAM_2129 provides insights into novel mechanisms of radioresistance distinct from those observed in better-studied model organisms like Deinococcus radiodurans. The combination of extreme thermostability and radioresistance in T. gammatolerans challenges conventional understanding of radiation resistance mechanisms and suggests that extremophiles may possess unique solutions to radiation damage . The study of proteins like TGAM_2129 expands our understanding of biological radiation protection beyond classical antioxidant enzymes and DNA repair systems, potentially revealing new conceptual frameworks for radiation resistance.

Future Research Directions

Based on current knowledge and identified gaps, several promising future research directions emerge:

  • Structural Biology Approaches:

    • Determine high-resolution crystal or cryo-EM structures of TGAM_2129, both alone and in complex with DNA

    • Characterize conformational changes upon DNA binding or metal coordination

    • Identify potential active sites or catalytic residues through structural analysis

  • Functional Characterization:

    • Develop comprehensive in vitro assays to test hypothesized activities (DNA protection, ROS scavenging, enzymatic functions)

    • Establish structure-function relationships through systematic mutagenesis

    • Identify physiological substrates or interaction partners through unbiased screening approaches

  • Systems Biology Integration:

    • Map the complete interaction network of TGAM_2129 within T. gammatolerans

    • Determine its role in global cellular responses to radiation through transcriptomic and proteomic approaches

    • Integrate findings into computational models of extremophile stress responses

  • Evolutionary Studies:

    • Perform detailed phylogenetic analyses to trace the evolutionary history of TGAM_2129 across archaea

    • Conduct ancestral sequence reconstruction to identify key adaptations enabling radioresistance

    • Investigate potential horizontal gene transfer events in the distribution of this protein family

  • Applied Research:

    • Explore biotechnological applications of TGAM_2129 in radiation protection or enzyme stabilization

    • Develop engineered variants with enhanced properties for specific applications

    • Investigate potential biomedical applications in radioprotection or cancer treatment

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.