Recombinant Thermococcus onnurineus Cobalamin synthase (cobS)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request to the best of our ability.
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; TON_0684; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Thermococcus onnurineus (strain NA1)
Target Names
cobS
Target Protein Sequence
MKNLLPFLTRVPIKGDFEKVREELWAFPLVALVSSALPTLVLYLKLPLSNVLAVLALYFT
IGLLHLDGLADFADGVMVKGNRERKIKAMKDLNTGIAGLFAVVMVLFLQVYSLQLVPFYA
IFLAELNSKLAMLLALATRKPLGQGLGAYFMERMNSGQLLGGFIFYAILLVPVVVYEQNA
LVSLLGLAFGGYAIKVALDNFGGINGDCIGAIAEITRAGTLLVVAFAGAYLGG
Uniprot No.
Target Background
Function
Cobalamin synthase (CobS) from Thermococcus onnurineus catalyzes the final two steps in cobalamin biosynthesis. It combines adenosylcobinamide-GDP and α-ribazole to produce adenosylcobalamin (Ado-cobalamin). Additionally, it synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.
Database Links
KEGG: ton:TON_0684
STRING: 523850.TON_0684
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
