Recombinant Thermococcus sibiricus Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Zinc-Dependent Proteolytic Activity

HtpX homologs are zinc metalloproteases that degrade misfolded membrane proteins and participate in stress response pathways . Key functional features include:

  • Self-degradation: HtpX undergoes autoproteolysis upon membrane solubilization, requiring zinc chelators for stabilization during purification .

  • Substrate specificity: Cleaves soluble (e.g., casein) and membrane proteins (e.g., SecY) .

  • Collaboration with FtsH: Works synergistically with the AAA+ protease FtsH to maintain membrane protein homeostasis .

Enzymatic Parameters

ParameterObservation
Optimal pH8.0 (Tris/PBS-based buffer)
CofactorZn²⁺-dependent
InhibitionEDTA (zinc chelation)
In Vivo AssayModel substrates enable semiquantitative activity analysis

Expression and Extraction

  • Expression: Achieved in E. coli BL21(DE3) using pET vectors with a C-terminal His tag .

  • Detergent solubilization: Octyl-β-D-glucoside effectively extracts HtpX from membranes .

Purification Workflow

  1. Cobalt-affinity chromatography: Isolates His-tagged protein .

  2. Anion-exchange chromatography: Removes contaminants .

  3. Size-exclusion chromatography: Ensures monodispersity .

Research Applications

  • Structural studies: High-purity HtpX enables crystallography and cryo-EM to resolve catalytic mechanisms .

  • Membrane protein quality control: Used to investigate degradation pathways for misfolded proteins .

  • Biotechnological tool: Engineered variants assess protease activity in vivo .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; TSIB_0972; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Thermococcus sibiricus (strain MM 739 / DSM 12597)
Target Names
htpX
Target Protein Sequence
MGLGMWLRTGVLMAFLTGLLMAIGYVLGNETGMMFAFMFALVMNFFSYWYSDKIVLTWYR ARILEEDEAPELYEIVRGLAQEAGIPTPKIAIVPTETPNAFATGRNPKNAVVAVTQGLLR ILNRDELEGVIAHELSHIKNRDVLIQTLAAVMAGAIMMVARWAGWMLWLGGFGGRDRDRD ASGALGAILLIVLAPIAAMLIQMAISRAREYLADETGAKISGKPWALARALEKIEHAVSM RPIKNGNPATAHMFIINPFRGVSFAELFSTHPPTQKRIERLRKIAENMGIAF
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is HtpX and what is its primary biological function?

HtpX is an integral membrane (IM) metallopeptidase that plays a central role in protein quality control by preventing the accumulation of misfolded proteins in the membrane . The HtpX protease specifically functions as a zinc-dependent endoprotease within the membrane-localized proteolytic system . In organisms like Escherichia coli, HtpX works in conjunction with FtsH (a membrane-bound and ATP-dependent protease) to participate in the proteolytic quality control of membrane proteins . The protein is part of the heat shock regulon, with its expression induced by temperature upshift, further supporting its role in managing protein stability under stress conditions .

What are the structural characteristics of Thermococcus sibiricus HtpX?

The Thermococcus sibiricus Protease HtpX homolog is a full-length protein consisting of 292 amino acids . Domain and structural analyses reveal that, like many thermophilic proteases, the T. sibiricus HtpX is membrane-bound and contains characteristic domains including peptidase M48, peptidase M50, PDZ, and CBS domains . These domains are critical for its catalytic function and substrate recognition. The protein features a hydrophobic profile consistent with its membrane integration, with multiple transmembrane segments that anchor it within the lipid bilayer while positioning the catalytic domain appropriately for proteolytic activity.

How does recombinant T. sibiricus HtpX differ from its E. coli counterpart?

While both proteins belong to the same family of membrane metalloproteases, T. sibiricus HtpX is derived from a thermophilic archaeon and thus exhibits enhanced thermostability compared to the mesophilic E. coli HtpX. The E. coli variant expresses as a 32-kDa protein and functions optimally at moderate temperatures , whereas the thermophilic T. sibiricus homolog maintains structural integrity and catalytic activity at significantly higher temperatures. This thermostability is conferred through adaptive amino acid composition, with higher frequencies of residues like alanine and leucine that promote protein rigidity through enhanced hydrophobic interactions and helical stability .

What are the optimal conditions for recombinant expression of T. sibiricus HtpX?

Based on current research practices, the optimal expression system for recombinant T. sibiricus HtpX utilizes E. coli BL21(DE3) cells transformed with a pET-derived vector that incorporates a His-tag (preferably N-terminal) for subsequent purification . The protein expression should be induced under controlled conditions, with careful consideration of the following parameters:

ParameterRecommended ConditionRationale
Host strainE. coli BL21(DE3)Reduced protease activity, T7 RNA polymerase expression
VectorpET-derived with His-tagTight regulation, high expression levels
Induction timingMid-logarithmic phaseBalance between cell density and protein production
InducerIPTG (0.1-1.0 mM)Controlled expression level
Post-induction temperature25-30°CReduced inclusion body formation
Media supplementationZinc (10-50 μM ZnSO₄)Cofactor for proper folding

When designing the expression construct, it's crucial to include the full coding sequence (1-292aa) while ensuring proper membrane integration through preservation of hydrophobic domains .

What purification strategy yields the highest quality recombinant T. sibiricus HtpX?

A multi-step purification approach is recommended to obtain homogeneous preparations of recombinant T. sibiricus HtpX. The following protocol has been optimized based on research with similar membrane metalloproteases:

  • Membrane extraction: Solubilize the membrane fraction using octyl-β-D-glucoside, which effectively extracts the membrane-bound protein while preserving its structural integrity .

  • Affinity chromatography: Utilize cobalt-affinity chromatography as the initial purification step, which offers higher specificity for His-tagged proteins compared to nickel-based matrices .

  • Ion-exchange chromatography: Apply anion-exchange chromatography as a secondary purification step to remove contaminants with different charge properties .

  • Size-exclusion chromatography: Perform gel filtration as the final purification step to achieve homogeneity and remove any aggregates or degradation products .

  • Buffer optimization: Maintain the purified protein in a stabilizing buffer containing the detergent at concentrations above its critical micelle concentration, supplemented with zinc ions to preserve the metalloprotease activity .

This purification strategy typically yields milligram quantities of pure and catalytically competent protein suitable for structural and biochemical studies .

How can self-degradation of HtpX during purification be prevented?

HtpX proteases are known to undergo self-degradation upon cell disruption or membrane solubilization, which presents a significant challenge during purification . To mitigate this issue, researchers should implement the following strategies:

  • Use of catalytically inactive mutants: Express catalytically ablated forms of the protease by introducing point mutations in the zinc-binding motif (typically HEXXH) .

  • Denaturing purification: Purify the protein under denaturing conditions using chaotropic agents like urea or guanidinium hydrochloride, followed by controlled refolding in the presence of a zinc chelator .

  • Zinc chelation: Include zinc chelators (e.g., EDTA or 1,10-phenanthroline) during initial extraction steps to temporarily inhibit the metalloprotease activity .

  • Rapid processing: Minimize the time between cell lysis and final purification steps, and maintain samples at reduced temperatures (4°C) throughout the process.

  • Protease inhibitors: Include a cocktail of protease inhibitors during extraction that does not interfere with zinc-dependent metalloproteases but inhibits other proteolytic enzymes.

When refolding is necessary, gradual removal of the denaturant in the presence of the zinc chelator, followed by controlled addition of zinc ions once the protein is properly folded, has proven effective in obtaining active enzyme .

What assays can be used to measure the proteolytic activity of T. sibiricus HtpX?

Several assays have been developed to assess the proteolytic activity of membrane metalloproteases like T. sibiricus HtpX:

  • Self-cleavage assay: Monitor the self-degradation of the purified enzyme when supplemented with zinc, using SDS-PAGE analysis to track the appearance of cleavage products over time .

  • Casein degradation: Assess the ability of the enzyme to degrade soluble substrates like casein, which can be quantified through release of acid-soluble peptides or using fluorescently labeled casein derivatives .

  • Membrane protein substrates: Evaluate the proteolytic activity against solubilized membrane proteins like SecY, which represents a more physiologically relevant substrate .

  • In vivo degradation assays: Co-express the protease with potential substrate proteins in E. coli and monitor substrate degradation through western blotting or reporter systems .

  • Synthetic peptide substrates: Use synthetic peptides containing appropriate recognition sequences conjugated to fluorogenic or chromogenic groups, allowing continuous monitoring of proteolytic activity.

For accurate activity measurements, it's essential to control zinc concentrations, detergent compositions, and reaction temperature, especially when comparing enzymes from thermophilic and mesophilic origins.

What are the optimal reaction conditions for T. sibiricus HtpX catalytic activity?

The thermophilic nature of T. sibiricus HtpX dictates unique optimal conditions for catalytic activity:

ParameterOptimal RangeNotes
Temperature60-80°CReflects thermophilic origin; activity increases significantly above 50°C
pH6.5-8.0Slightly alkaline conditions typically optimal
Zinc concentration0.1-1.0 mMEssential cofactor; higher concentrations may inhibit
Detergent1-2× CMC of non-ionic detergentsRequired for solubilization; concentration must be above CMC
Ionic strength50-150 mM NaClModerate ionic strength stabilizes activity
Reducing agents1-5 mM DTT or β-mercaptoethanolHelps maintain reduced state of cysteine residues

It's important to note that while the enzyme demonstrates maximal activity at elevated temperatures, the stability of detergent micelles and substrate proteins may become limiting factors in prolonged high-temperature reactions.

How does the substrate specificity of T. sibiricus HtpX compare to other metalloproteases?

T. sibiricus HtpX, like other members of the HtpX family, exhibits distinct substrate preferences that set it apart from other metalloproteases:

  • Membrane protein preference: T. sibiricus HtpX preferentially cleaves misfolded or damaged membrane proteins, similar to E. coli HtpX, which targets proteins like SecY .

  • Recognition elements: The presence of PDZ and CBS domains suggests that the enzyme recognizes specific structural features or sequences within substrate proteins, rather than having broad proteolytic activity .

  • Complementarity with other proteases: HtpX proteases often work in conjunction with other proteolytic systems (like FtsH in E. coli), suggesting a specialized role within a broader proteolytic network .

  • Thermostability-related differences: The T. sibiricus enzyme likely exhibits altered substrate recognition compared to mesophilic homologs due to adaptations in its binding pocket that enhance thermostability .

  • Zinc dependency: Like other metalloproteases, T. sibiricus HtpX absolutely requires zinc for catalytic activity, distinguishing it from serine or cysteine proteases .

Understanding these specificity determinants is crucial for designing experiments to study the enzyme's physiological role and for developing potential biotechnological applications.

How can structural studies of T. sibiricus HtpX contribute to understanding catalytic mechanisms of integral membrane proteases?

Structural characterization of T. sibiricus HtpX offers unique opportunities to elucidate the catalytic mechanisms of integral membrane proteases, which remain poorly understood compared to their soluble counterparts . Several approaches can contribute to this understanding:

  • X-ray crystallography: The availability of milligram quantities of purified protein enables crystallization trials, potentially providing atomic-resolution structures that reveal the spatial arrangement of catalytic residues, substrate binding pockets, and transmembrane domains .

  • Cryo-electron microscopy: For membrane proteins that resist crystallization, cryo-EM has emerged as a powerful alternative for structural determination, particularly when the protein is reconstituted into nanodiscs or lipid environments.

  • Site-directed mutagenesis: Systematic mutation of conserved residues, particularly within the HEXXH motif and other potential zinc-coordinating sites, can identify critical catalytic and structural elements.

  • Molecular dynamics simulations: Computational approaches can model the protein within a membrane environment, providing insights into conformational changes, substrate access channels, and the role of specific residues in catalysis.

  • Hydrogen-deuterium exchange mass spectrometry: This technique can map the solvent accessibility of different protein regions, helping to identify potential substrate binding sites and conformational changes during catalysis.

These structural studies, particularly of a thermostable homolog like T. sibiricus HtpX, can reveal adaptations that enable catalysis within the membrane environment under extreme conditions, advancing our understanding of membrane proteolysis more broadly .

What strategies can be employed to identify physiological substrates of T. sibiricus HtpX?

Identifying the physiological substrates of T. sibiricus HtpX requires specialized approaches due to its membrane localization and thermophilic nature:

  • Comparative proteomics: Compare membrane proteome profiles between wild-type T. sibiricus and strains with overexpressed or deleted htpX gene, using quantitative mass spectrometry to identify proteins whose abundance changes.

  • Activity-based protein profiling: Develop activity-based probes that covalently label the active site of HtpX, allowing for isolation of enzyme-substrate complexes.

  • Substrate trapping mutants: Generate catalytically inactive variants that can still bind but not cleave substrates, creating stable enzyme-substrate complexes amenable to isolation and identification.

  • Proximal labeling approaches: Fuse HtpX to enzymes like BioID or APEX2 that biotinylate or otherwise tag proteins in close proximity, allowing identification of proteins that transiently interact with HtpX.

  • Heterologous expression systems: Express T. sibiricus HtpX in model organisms like E. coli and identify degraded proteins using proteomics approaches, similar to studies that identified SecY as a substrate of E. coli HtpX .

  • In vitro reconstitution: Purify candidate substrate proteins and assess their susceptibility to cleavage by purified T. sibiricus HtpX under controlled conditions.

These approaches, particularly when used in combination, can reveal the substrate network of T. sibiricus HtpX and provide insights into its physiological role in thermophilic protein quality control.

How do amino acid composition differences contribute to the thermostability of T. sibiricus HtpX?

The thermostability of T. sibiricus HtpX is largely attributable to its distinctive amino acid composition, which differs from mesophilic homologs in several key aspects:

A comparative analysis of amino acid frequencies between T. sibiricus HtpX and its mesophilic counterpart reveals these adaptations:

Amino AcidFunction in ThermostabilityAbundance in T. sibiricus vs. Mesophilic HtpX
AlanineHelix stabilizationHigher
LeucineHydrophobic core packingHigher
IsoleucineHydrophobic interactionsHigher
ValineHydrophobic interactionsHigher
GlycineConformational flexibilityLower
ProlineLoop regions, reduced flexibilityVariable
ArginineSalt bridge formationHigher
GlutamateSalt bridge formationHigher
CysteineDisulfide bond formationLower

These compositional differences work synergistically to maintain protein structure and function at the elevated temperatures encountered in the natural habitat of T. sibiricus .

How can low expression yields of recombinant T. sibiricus HtpX be improved?

Low expression yields of recombinant membrane proteins like T. sibiricus HtpX are a common challenge. Several strategies can be implemented to improve yields:

  • Codon optimization: Adjust the coding sequence to match the codon usage preference of the expression host, which can significantly improve translation efficiency.

  • Expression vector selection: Test multiple expression vectors with different promoter strengths, fusion tags, and regulatory elements to identify optimal expression conditions .

  • Host strain optimization: Screen various E. coli strains specifically designed for membrane protein expression, such as C41(DE3), C43(DE3), or Lemo21(DE3) .

  • Induction parameters: Systematically vary IPTG concentration (0.01-1.0 mM), induction temperature (15-37°C), and induction duration (3-24 hours) to identify conditions that balance expression level with proper folding .

  • Media supplementation: Enrich expression media with components that support membrane protein folding, such as glycerol (0.5-2%), specific metal ions, or chemical chaperones .

  • Growth conditions: Implement fed-batch cultivation with controlled nutrient feeding to achieve higher cell densities while maintaining protein production .

  • Co-expression of chaperones: Co-express molecular chaperones (e.g., GroEL/GroES) that assist in proper protein folding, particularly for thermophilic proteins expressed in mesophilic hosts.

These approaches, especially when combined, can significantly enhance the yield of functional recombinant T. sibiricus HtpX.

What measures can prevent proteolytic degradation during recombinant T. sibiricus HtpX production?

Proteolytic degradation during production is a significant challenge when expressing recombinant proteases like T. sibiricus HtpX. The following measures can minimize this issue:

  • Expression of inactive mutants: Introduce point mutations in the catalytic site (e.g., in the HEXXH motif) to produce catalytically inactive but structurally intact protein .

  • Protease-deficient host strains: Utilize E. coli strains with reduced protease activity, such as BL21(DE3) or specialized derivatives with multiple protease gene deletions .

  • Optimal induction timing: Induce expression at the appropriate cell density to minimize stress responses that activate host proteases .

  • Media supplementation: Include metabolites like glutamic acid or components from tryptone soy broth in the post-induction phase, which have been shown to reduce protease activity in high cell density cultivations .

  • Temperature management: Lower the post-induction cultivation temperature to reduce the activity of host proteases while maintaining expression .

  • Addition of protease inhibitors: Add protease inhibitors during cell disruption and initial purification steps to minimize degradation.

  • Rapid processing: Minimize the time between harvest and purification, and perform all steps at reduced temperatures to limit proteolytic activity.

These strategies address both self-degradation by the recombinant protease and degradation by host cell proteases, which are distinct issues that can occur simultaneously .

How can researchers differentiate between active and inactive forms of T. sibiricus HtpX?

Distinguishing between active and inactive forms of T. sibiricus HtpX is essential for accurate characterization. Several methods can be employed:

  • Zinc-dependent activity assays: Measure proteolytic activity in the presence and absence of zinc ions, as activity should be strictly zinc-dependent . Compare activity with and without zinc chelators like EDTA or 1,10-phenanthroline.

  • Self-cleavage analysis: Monitor the ability of the protein to undergo self-cleavage when supplemented with zinc ions, which is a characteristic of active metalloproteases .

  • Active site labeling: Use active site-directed probes that selectively modify the catalytic residues in functional enzymes but not in inactive forms.

  • Thermal shift assays: Measure protein stability in the presence and absence of zinc ions; active enzyme typically exhibits a higher melting temperature when the metal cofactor is present.

  • Substrate binding assays: Even when catalytically inactive, properly folded enzyme should retain substrate binding capacity, which can be assessed through binding assays.

  • Circular dichroism spectroscopy: Compare secondary structure profiles between purified proteins and reference standards to confirm proper folding.

  • Size-exclusion chromatography: Analyze the elution profile to detect potential aggregation or conformational changes associated with inactive forms.

By combining these approaches, researchers can confidently differentiate between active enzyme, properly folded but inactive enzyme (e.g., due to absence of zinc), and misfolded or denatured protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.