Recombinant Thermodesulfovibrio yellowstonii ATP synthase subunit c (atpE)

What is Thermodesulfovibrio yellowstonii and why is its ATP synthase subunit c (atpE) significant for research?

Thermodesulfovibrio yellowstonii is a thermophilic sulfate-reducing bacterium isolated from thermal vent water in Yellowstone Lake, Wyoming. This gram-negative, curved rod-shaped bacterium represents a phylogenetically distinct lineage that branches deeply within the Bacteria domain. The organism grows optimally at 65°C (range: 40-70°C) and utilizes sulfate, thiosulfate, and sulfite as electron acceptors . The ATP synthase subunit c (atpE) from this extremophile is of particular research interest because it provides insights into thermostable protein adaptations and evolutionary aspects of bioenergetic systems functioning under extreme conditions. Understanding the structural and functional characteristics of this protein contributes to our knowledge of energy metabolism in ancient bacterial lineages and thermal adaptation mechanisms .

How does the structure of T. yellowstonii atpE differ from mesophilic bacterial homologs?

T. yellowstonii atpE consists of 110 amino acids with the sequence MRKFFVILMVALVVVLTASAVFAADSDPAKLNYYGYATAGALIGLGAAAGGGGAGMGQGLRGILEGSARNPGVTGKLMTLFIVGLALIESLVIYVLVFVLITFYANPFVK . Comparative analysis with mesophilic bacterial homologs reveals several distinctive features:

The increased hydrophobicity and glycine-rich regions likely contribute to maintaining structural integrity and flexibility at elevated temperatures, representing evolutionary adaptations to the organism's thermophilic lifestyle .

How might the thermophilic adaptations of T. yellowstonii atpE affect its functional properties?

The thermophilic adaptations of T. yellowstonii atpE likely produce several functional consequences:

• Modified proton-binding sites optimized for function at elevated temperatures

• Potentially altered proton affinity or pKa values of key residues

• Specialized lipid-protein interactions that maintain functional integrity at high temperatures

• Potentially modified rotational dynamics of the c-ring

• Specialized coupling mechanisms with other ATP synthase subunits adapted for thermostability

These adaptations ensure ATP synthase remains functional under the extreme conditions of thermal vents while maintaining the fundamental coupling mechanism between proton translocation and ATP synthesis .

What expression systems are most effective for producing recombinant T. yellowstonii atpE?

Based on current methodologies, E. coli serves as an effective heterologous expression system for recombinant T. yellowstonii atpE . Successful expression requires several key considerations:

• Vector selection with appropriate promoters for membrane protein expression

• Fusion tags (N-terminal His-tag has been demonstrated successfully)

• Optimization of induction conditions considering the hydrophobic nature of the protein

• Potential codon optimization for E. coli expression

• Lower induction temperatures to facilitate proper membrane protein folding

• Careful selection of E. coli strains optimized for membrane protein expression

While E. coli is the established system, researchers investigating functional aspects might consider alternative expression systems closer to the native thermophilic environment for certain applications .

What purification protocol yields highest purity and activity for recombinant T. yellowstonii atpE?

The following purification protocol has been demonstrated to achieve >90% purity for recombinant His-tagged T. yellowstonii atpE:

• Affinity chromatography using Ni-NTA resin for His-tagged protein

• Careful selection of detergents for membrane protein solubilization

• Optimized buffer conditions (Tris/PBS-based buffer with 6% trehalose, pH 8.0)

• Quality control via SDS-PAGE to verify purity

• Final preparation as lyophilized powder for stability

For functional studies, additional considerations include:

• Detergent selection based on maintenance of structural integrity

• Incorporation of protease inhibitors throughout purification

• Potential inclusion of stabilizing agents specific to thermophilic proteins

• Verification of conformational integrity through spectroscopic methods

What are the optimal storage conditions for maintaining stability of purified T. yellowstonii atpE?

To maintain long-term stability of purified T. yellowstonii atpE:

• Store lyophilized powder at -20°C/-80°C

• Upon reconstitution, prepare working aliquots to avoid repeated freeze-thaw cycles

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (50% recommended) for long-term storage

• Store working aliquots at 4°C for up to one week

• Avoid repeated freeze-thaw cycles which significantly reduce protein integrity

These storage recommendations ensure maintenance of protein structure and function for experimental applications over extended periods .

How should researchers design experiments to compare T. yellowstonii atpE with other bacterial homologs?

Designing rigorous comparative experiments between T. yellowstonii atpE and other bacterial homologs requires:

• Expression standardization:

  • Use identical tags and expression systems where possible

  • Normalize protein concentrations precisely

  • Verify structural integrity through multiple methods

• Temperature considerations:

  • Include experiments at both mesophilic (25-37°C) and thermophilic (65°C) temperatures

  • Use temperature-stable buffers and reagents

  • Account for different kinetic parameters at elevated temperatures

• Functional assays:

  • Develop standardized proton translocation assays applicable across temperature ranges

  • Use reconstituted systems with controlled lipid compositions

  • Implement multiple complementary techniques to verify findings

• Controls:

  • Include well-characterized reference proteins (both mesophilic and thermophilic)

  • Design experiments with appropriate negative controls

  • Utilize mutant proteins to verify functional hypotheses

What methodological challenges arise when studying proton translocation through the T. yellowstonii c-ring?

Several methodological challenges complicate the study of proton translocation through thermophilic ATP synthase components:

• Temperature stability issues:

  • Standard fluorescent probes may be unstable at thermophilic temperatures

  • Conventional membrane systems might not maintain integrity at 65°C

  • Solution: Develop specialized thermostable fluorophores and lipid systems

• Reconstitution difficulties:

  • Achieving proper orientation in liposomes

  • Maintaining functional integrity during reconstitution

  • Solution: Optimize reconstitution protocols specifically for thermophilic membrane proteins

• Measurement considerations:

  • Increased reaction rates at elevated temperatures require faster detection methods

  • Higher background signals at elevated temperatures

  • Solution: Implement rapid kinetic techniques with enhanced signal processing

• Buffer considerations:

  • pH changes of buffers at different temperatures

  • Solution: Use temperature-compensated buffer systems with minimal temperature dependence

How can researchers effectively measure the thermostability of recombinant T. yellowstonii atpE?

Effective measurement of thermostability for T. yellowstonii atpE should employ multiple complementary techniques:

• Differential Scanning Calorimetry (DSC):

  • Determines melting temperature (Tm) and thermodynamic parameters

  • Provides quantitative comparison with mesophilic homologs

  • Reveals thermal unfolding profile

• Circular Dichroism (CD) Spectroscopy:

  • Monitors secondary structure changes with temperature

  • Provides information on structural transitions

  • Can be performed with temperature ramping

• Functional Thermostability:

  • Assay functional activity after exposure to various temperatures

  • Determine temperature at which 50% activity is retained

  • Monitor recovery after thermal stress

• Intrinsic Fluorescence:

  • Track conformational changes through tryptophan fluorescence

  • Monitor unfolding process at increasing temperatures

  • Determine resistance to thermal denaturation

How can structural data from T. yellowstonii atpE inform the design of thermostable biocatalysts?

Structural analysis of T. yellowstonii atpE provides valuable insights for designing thermostable biocatalysts:

• Identification of thermostability determinants:

  • Amino acid composition patterns favoring thermostability

  • Specific structural motifs conferring thermal resistance

  • Hydrophobic interaction networks that maintain structural integrity

• Engineering approaches:

  • Rational introduction of stabilizing residues at key positions

  • Incorporation of identified glycine-rich motifs (e.g., GAAAGGGGAG sequence)

  • Implementation of specialized salt bridge networks based on thermophilic patterns

• Membrane protein design principles:

  • Optimization of hydrophobic membrane-spanning regions

  • Design of thermostable protein-lipid interfaces

  • Creation of rigid core structures with flexible functional regions

• Application scenarios:

  • Development of thermostable industrial enzymes

  • Creation of robust biosensors for extreme environments

  • Engineering of energy-transducing membrane proteins with enhanced stability

What evolutionary insights can be gained from comparing T. yellowstonii atpE with other bacterial ATP synthase components?

Comparative analysis of T. yellowstonii atpE provides several evolutionary insights:

• Ancient lineage characteristics:

  • T. yellowstonii represents a deeply branching bacterial lineage

  • Its ATP synthase components may retain ancestral features

  • Comparison reveals conservation of core functional elements across vast evolutionary distances

• Thermophilic adaptations:

  • Identification of convergent adaptations in unrelated thermophiles

  • Distinction between ancestral thermophilic traits versus later adaptations

  • Understanding of evolutionary pressures driving thermostability

• Structural conservation:

  • Analysis of structurally conserved residues critical for function

  • Identification of lineage-specific innovations in the ATP synthase complex

  • Mapping of evolutionary trajectories in the ATP synthase machinery

• Phylogenetic implications:

  • Contribution to understanding early bioenergetic systems

  • Insights into the evolution of cellular energy metabolism

  • Perspective on adaptation of fundamental cell machinery to extreme environments

How might T. yellowstonii atpE interact with inhibitors compared to mesophilic homologs?

Understanding inhibitor interactions with T. yellowstonii atpE compared to mesophilic homologs reveals:

• Binding site adaptations:

  • Potential structural differences in inhibitor binding pockets

  • Modified accessibility of binding sites at elevated temperatures

  • Altered electrostatic environments affecting inhibitor affinity

• Inhibitor stability considerations:

  • Thermal stability of inhibitor molecules at thermophilic temperatures

  • Potential requirement for thermostable inhibitor design

  • Different binding kinetics at elevated temperatures

• Comparative inhibition studies:

  • Known ATP synthase inhibitors may show different efficacies against thermophilic versions

  • Temperature-dependent inhibition profiles provide mechanistic insights

  • Differential inhibition patterns reveal structural and functional variations

• Therapeutic relevance:

  • While not directly applicable to T. yellowstonii, comparative studies with bacterial pathogens (like M. tuberculosis) inform drug development

  • Understanding of how drugs like TMC207 interact with ATP synthase components

  • Insights into resistance mechanisms and binding determinants

What are common challenges in expressing and purifying recombinant T. yellowstonii atpE and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant T. yellowstonii atpE:

Systematic optimization of these parameters significantly improves experimental outcomes when working with this challenging thermophilic membrane protein .

How can researchers distinguish between effects of the His-tag and intrinsic properties of T. yellowstonii atpE?

To differentiate between tag-induced artifacts and intrinsic properties of T. yellowstonii atpE:

• Comparative expression strategies:

  • Express both N-terminal and C-terminal His-tagged versions

  • Create a tag-cleavable construct and compare before/after cleavage

  • Express untagged protein through alternative purification strategies

• Functional validation:

  • Compare activity of tagged vs. untagged protein after reconstitution

  • Assess oligomerization properties with different tag configurations

  • Measure proton translocation efficiency with and without tags

• Structural assessment:

  • Perform CD spectroscopy to compare secondary structure profiles

  • Use limited proteolysis to assess structural differences

  • Conduct thermal stability comparisons between tagged/untagged versions

• Control experiments:

  • Include tagged and untagged versions of well-characterized reference proteins

  • Systematically evaluate the impact of tag position on various functional parameters

  • Use site-directed mutagenesis to assess interaction between tag and key functional residues

What are the key considerations for reconstituting T. yellowstonii atpE for functional studies?

Successful reconstitution of T. yellowstonii atpE requires careful attention to several factors:

• Lipid composition optimization:

  • Consider using lipids from thermophilic organisms

  • Test various phospholipid compositions

  • Determine optimal protein:lipid ratios

  • Evaluate lipid mixtures that maintain fluidity at thermophilic temperatures

• Reconstitution method selection:

  • Detergent dialysis versus direct incorporation

  • Bio-bead removal of detergents

  • Gradual versus rapid detergent removal

  • Temperature considerations during reconstitution process

• Orientation control:

  • Verify insertion orientation through protease accessibility assays

  • Optimize protocols to achieve uniform orientation

  • Implement functional assays to confirm proper orientation

• Functional validation:

  • Proton permeability assays using pH-sensitive fluorescent dyes

  • Membrane potential measurements

  • ATP-driven proton pumping when combined with F1 components

  • Comparison with native membrane preparations

How should researchers interpret thermostability data for T. yellowstonii atpE compared to mesophilic homologs?

Proper interpretation of thermostability data requires several analytical considerations:

• Temperature of origin context:

  • Compare results to the organism's growth temperature (optimal: 65°C)

  • Evaluate relative stability (°C above growth temperature) rather than absolute values

  • Consider the ecological niche when interpreting thermodynamic parameters

• Multi-parameter analysis:

  • Assess both thermodynamic stability (ΔG of unfolding) and kinetic stability (unfolding rates)

  • Evaluate enthalpy-entropy compensation effects

  • Consider the temperature dependence of stability parameters

• Structure-function relationships:

  • Correlate stability data with specific structural features

  • Identify stabilizing mechanisms (hydrophobic interactions, salt bridges, etc.)

  • Map thermal unfolding patterns to functional domains

• Comparative framework:

  • Establish appropriate reference points from both mesophilic and other thermophilic organisms

  • Consider protein family-specific stability patterns

  • Account for membrane environment effects on apparent stability

What bioinformatic approaches are most valuable for analyzing T. yellowstonii atpE in an evolutionary context?

Several bioinformatic approaches provide valuable insights into T. yellowstonii atpE evolution:

• Multiple sequence alignment analysis:

  • Alignment with diverse bacterial ATP synthase c subunits

  • Identification of conserved residues across phylogenetic distances

  • Detection of thermophile-specific sequence patterns

• Homology modeling approaches:

  • Structure prediction based on resolved ATP synthase structures

  • Comparative modeling with mesophilic and thermophilic homologs

  • Identification of thermostability-conferring structural features

• Molecular dynamics simulations:

  • Simulations at different temperatures to assess thermal stability

  • Analysis of conformational flexibility and rigidity

  • Evaluation of water and ion interactions at elevated temperatures

• Evolutionary analyses:

  • Ancestral sequence reconstruction

  • Molecular clock analyses to date divergence events

  • Selection pressure analysis to identify adaptively evolving sites

  • Comparison with c subunits from archaea and other ancient lineages

How can researchers differentiate between experimental artifacts and genuine functional properties in studies of T. yellowstonii atpE?

To distinguish artifacts from genuine properties when studying T. yellowstonii atpE:

• Multiple methodological approaches:

  • Verify key findings through complementary techniques

  • Use both in vitro and membrane-reconstituted systems

  • Compare results across different expression/purification batches

• Systematic control experiments:

  • Include well-characterized reference proteins

  • Perform parallel experiments with mutant versions

  • Test under various conditions to identify parameter-dependent artifacts

• Statistical validation:

  • Ensure appropriate replication of experiments

  • Apply rigorous statistical tests to quantify significance

  • Evaluate reproducibility across different experimental setups

• Temperature-dependent validation:

  • Perform experiments across temperature ranges

  • Identify properties that scale predictably with temperature

  • Distinguish thermal artifacts from genuine thermophilic adaptations