Recombinant Thermodesulfovibrio yellowstonii Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction to LspA and Its Biological Role

Lipoprotein signal peptidase (LspA) is a type II signal peptidase (SPase II) responsible for cleaving the signal peptide of bacterial lipoproteins, enabling their maturation and proper localization in the outer membrane . In Thermodesulfovibrio yellowstonii, a thermophilic sulfate-reducing bacterium isolated from Yellowstone Lake (USA) , LspA plays a critical role in processing lipoproteins essential for cellular functions such as nutrient transport and stress response .

Recombinant LspA Production and Characterization

Recombinant T. yellowstonii LspA is expressed in Escherichia coli for biochemical and structural studies. Key features include:

Table 2: SPase II Activity Across Bacterial Species

OrganismSPase II Activity in E. coli ComplementationGlobomycin ResistanceReference
Rickettsia typhiPartial restorationModerate
Thermodesulfovibrio yellowstoniiFunctional (confirmed via assays)High
Pseudomonas aeruginosaN/AHigh (structural basis)

Future Directions

Further studies should focus on:

  • Crystallography: Resolving T. yellowstonii LspA’s 3D structure to refine inhibitor design .

  • Metabolic Engineering: Leveraging LspA for industrial lipoprotein production .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will accommodate your request.
Lead Time
Delivery time may vary based on your purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a particular tag type preference, please inform us, and we will prioritize its development.
Synonyms
lspA; THEYE_A0655; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Target Names
lspA
Target Protein Sequence
MSLKLYKTSISIFLILLIDQITKYLAIKFLSPDGIVKLLPFLNLVYVENTGTAFGMFKFL GSGFFIIIALVVTGFLVYMYFKDTQNWFIYSLIIAGALGNIIDRLIYGYVIDFIDLHLKN LHWPAFNVADSAISIGIVLFVYKNLKK
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the predicted structure of T. yellowstonii LspA based on homology to other bacterial LspA proteins?

T. yellowstonii LspA likely shares the core structural features found in other bacterial LspA proteins, including four transmembrane helices (H1-H4) with catalytic aspartate residues positioned toward the membrane's outer surface . Based on the S. aureus LspA structure, T. yellowstonii LspA would likely contain a β-cradle, a hemi-cylindrically shaped sheet that sits on the membrane and accommodates substrate lipoproteins . As a thermophilic protein, T. yellowstonii LspA may contain additional stabilizing features such as increased hydrophobic interactions, additional salt bridges, and reduced flexible loops compared to mesophilic homologs.

To predict the structure with greater accuracy, researchers should:

  • Perform sequence alignment with characterized LspA proteins, particularly focusing on catalytic residues

  • Use homology modeling software with the S. aureus LspA crystal structure as a template

  • Validate the model through molecular dynamics simulations under elevated temperature conditions

What are the essential catalytic residues in bacterial LspA and how are they likely conserved in T. yellowstonii?

Bacterial LspA enzymes function as aspartyl proteases with a catalytic dyad composed of two highly conserved aspartate residues. In S. aureus LspA, these residues are Asp118 and Asp136 . These catalytic aspartates are essential for the cleavage of the signal peptide from prolipoprotein substrates.

To identify these residues in T. yellowstonii LspA:

  • Perform multiple sequence alignment of the T. yellowstonii LspA sequence with characterized LspA proteins

  • Look for the DxxK motif, which typically contains the first catalytic aspartate

  • Identify the second aspartate approximately 18-20 residues downstream

  • Confirm conservation of other functional residues, such as those involved in substrate binding

How does the thermophilic nature of T. yellowstonii potentially affect LspA structure and function?

As a protein from a thermophilic organism, T. yellowstonii LspA would likely exhibit several adaptations for function at elevated temperatures:

  • Enhanced structural stability through increased hydrophobic core packing

  • Higher proportion of charged amino acids forming stabilizing salt bridges

  • Reduced number and length of surface loops to minimize conformational flexibility

  • Potential disulfide bonds to provide additional structural stability

  • Optimized activity at temperatures corresponding to T. yellowstonii's growth optimum (65-70°C)

These thermostability features may affect experimental approaches, as the protein might exhibit reduced activity at lower temperatures while maintaining structural integrity under conditions that would denature mesophilic homologs.

What is the essential role of LspA in bacterial physiology that would apply to T. yellowstonii?

LspA plays a critical role in bacterial lipoprotein processing by cleaving the signal peptide from prolipoproteins after they have been lipid-modified by Lgt . In pathogenic bacteria like S. aureus, LspA activity has been shown to be important for survival in human blood, suggesting a role in virulence and immune evasion . Although T. yellowstonii is not a human pathogen, its LspA would likely be essential for:

  • Proper processing and localization of membrane lipoproteins

  • Maintaining cell envelope integrity under thermophilic conditions

  • Supporting specialized metabolic functions related to sulfate reduction

  • Potential roles in adhesion to surfaces in thermal environments

What expression systems would be most suitable for recombinant production of T. yellowstonii LspA?

Based on successful approaches with other bacterial LspA proteins, the following expression systems could be considered:

  • E. coli C43(DE3): This strain, used successfully for S. aureus LspA expression , is designed for toxic and membrane protein expression and would likely be suitable for T. yellowstonii LspA.

  • Vector selection: pET28a with a hexahistidine tag and TEV protease cleavage site has proven effective for S. aureus LspA and could be adapted for T. yellowstonii LspA.

  • Expression conditions table:

ParameterRecommended ConditionRationale
Expression temperature30°CBalance between protein folding and expression level
Induction1 mM IPTG at OD600 0.5-0.6Optimal for membrane protein expression
MediaTB with appropriate antibioticRich media for higher cell density
Expression time18 hoursExtended time for proper folding
  • Codon optimization: The T. yellowstonii LspA gene should be codon-optimized for E. coli expression using algorithms that account for rare codons .

What purification strategies would be effective for T. yellowstonii LspA?

Based on successful purification of other bacterial LspA proteins, a multi-step purification strategy would be recommended:

  • Membrane fraction isolation: Since LspA is a membrane protein, proper isolation of the membrane fraction is critical through differential centrifugation.

  • Detergent solubilization: Test multiple detergents including LMNG (lauryl maltose neopentyl glycol), which has been effective for S. aureus LspA .

  • Immobilized metal affinity chromatography (IMAC): Using the hexahistidine tag for initial purification.

  • Tag removal: TEV protease digestion to remove the tag, which has been shown to improve crystallization success for S. aureus LspA .

  • Size exclusion chromatography: As a final polishing step to achieve high purity and remove aggregates.

  • Thermostability advantage: Consider incorporating a heat treatment step (60-65°C) that would denature E. coli proteins while potentially preserving the thermostable T. yellowstonii LspA.

How can the thermostability of T. yellowstonii LspA be leveraged during purification?

The thermophilic nature of T. yellowstonii LspA provides unique opportunities during purification:

  • Heat treatment: Applying a heat step (60-70°C) after initial extraction may selectively denature contaminating E. coli proteins while preserving active T. yellowstonii LspA.

  • Stability in harsh conditions: The protein may tolerate higher concentrations of denaturants during purification steps, allowing more stringent washing.

  • Extended shelf-life: Purified thermostable proteins often exhibit extended stability at room temperature, potentially simplifying handling requirements.

  • Purification at elevated temperatures: Conducting chromatography steps at higher temperatures may maintain the protein in its native conformation while reducing contamination.

  • Buffer optimization: Testing buffers that mimic T. yellowstonii's natural environment, including higher salt concentrations and pH optimums relevant to thermophilic conditions.

What assay methods can be used to measure the enzymatic activity of purified T. yellowstonii LspA?

Based on established methods for other bacterial LspA proteins, the following assays could be adapted for T. yellowstonii LspA:

  • Gel-shift assay: A coupled assay where a recombinant prolipoprotein substrate (such as proICP) is first lipidated by Lgt and then processed by LspA, with products separated by SDS-PAGE . This assay would need to be modified to function at higher temperatures appropriate for a thermophilic enzyme.

  • FRET-based assay: Using a single molecule FRET lipopeptide substrate to monitor cleavage in real-time . This allows for more precise kinetic measurements and is adaptable to high-throughput screening.

  • Mass spectrometry: To detect the cleaved signal peptide or processed lipoprotein, providing high specificity for confirming enzymatic activity.

  • Thermophilic considerations: All assays would need temperature optimization, potentially running reactions at 60-70°C to match T. yellowstonii's natural growth conditions.

How should inhibition studies be designed for T. yellowstonii LspA?

Inhibition studies can provide valuable insights into catalytic mechanism and potential antibacterial targets:

  • Known LspA inhibitors: Test established inhibitors like globomycin and myxovirescin that bind to the active site as non-cleavable tetrahedral intermediate analogs .

  • Inhibitor binding analysis:

InhibitorExpected binding modeTemperature considerations
Globomycinβ-hydroxyl of g.Ser between catalytic aspartatesMay have altered affinity at thermophilic temperatures
MyxovirescinSimilar binding mode despite different structureThermal stability of inhibitor must be considered
  • IC50 determination: Perform dose-response assays with varying inhibitor concentrations to determine IC50 values, which may differ significantly from mesophilic enzymes due to different conformational dynamics .

  • Temperature effects: Compare inhibition at different temperatures to understand how thermal energy affects inhibitor binding and enzyme conformation.

How can substrate specificity of T. yellowstonii LspA be determined?

Understanding substrate specificity would provide insights into the biological function and evolutionary adaptations of T. yellowstonii LspA:

  • Genomic analysis: Identify putative lipoprotein substrates in the T. yellowstonii genome by searching for lipobox motifs in predicted signal sequences.

  • Synthetic peptide library: Test a library of peptides with variations in the lipobox region to determine sequence preferences.

  • Heterologous substrates: Test the ability of T. yellowstonii LspA to process lipoproteins from different bacterial species, including both mesophilic and thermophilic organisms.

  • Kinetic parameter determination: Measure Km and Vmax values for different substrates to quantify preference, and compare these values at different temperatures to understand thermophilic adaptation.

  • Extracellular loop (EL) analysis: Based on insights from S. aureus LspA, analyze the flexibility of the extracellular loop between strand 2 and H2, which has been shown to be important for substrate recognition and inhibitor binding .

What structural biology approaches would be most effective for T. yellowstonii LspA?

Several complementary approaches could be employed to determine the structure of T. yellowstonii LspA:

  • X-ray crystallography: The successful crystallization of S. aureus LspA using the in meso method suggests this approach could work for T. yellowstonii LspA . The thermostability may actually facilitate crystallization by reducing conformational flexibility.

  • Cryo-electron microscopy: Particularly useful if crystallization proves challenging, though the relatively small size of LspA (approximately 18-20 kDa) may present resolution limitations.

  • NMR spectroscopy: For analyzing dynamic regions and inhibitor binding, particularly focusing on the extracellular loop region identified as critical in S. aureus LspA .

  • Molecular dynamics simulations: To understand conformational changes at elevated temperatures and compare with mesophilic homologs.

  • Tag considerations: As observed with S. aureus LspA, removal of the hexahistidine tag may be necessary for successful crystallization .

What key residues should be targeted for site-directed mutagenesis studies?

Based on insights from other bacterial LspA proteins, the following residues would be priority targets for mutagenesis:

  • Catalytic aspartates: The presumed catalytic dyad (equivalent to Asp118 and Asp136 in S. aureus LspA) should be mutated to confirm their essential role.

  • Extracellular loop residues: Particularly the glycine residue equivalent to Gly54 in S. aureus LspA, which when mutated to proline completely inactivated the enzyme by limiting loop flexibility .

  • Substrate binding pocket residues: Amino acids predicted to form the substrate binding pocket, particularly those that interact with the lipobox of substrate proteins.

  • Thermostability-associated residues: Amino acids unique to T. yellowstonii LspA compared to mesophilic homologs, particularly charged residues that might form stabilizing salt bridges.

  • Transmembrane interface residues: Residues at the membrane interface that may be involved in substrate recognition or membrane association.

How does the extracellular loop flexibility observed in S. aureus LspA inform studies of T. yellowstonii LspA?

The extracellular loop (EL) between strand 2 and H2 in S. aureus LspA demonstrates remarkable flexibility that is essential for inhibitor binding and likely substrate processing . For T. yellowstonii LspA:

  • Thermophilic adaptation: The loop may have evolved different flexibility characteristics to maintain function at high temperatures while preventing denaturation.

  • Functional hypotheses:

    • The loop may be shorter in thermophilic LspA to enhance stability

    • Alternative stabilizing interactions might compensate for reduced flexibility

    • The conformational changes might be conserved but occur at higher energy thresholds

  • Experimental approaches:

    • Hydrogen-deuterium exchange mass spectrometry to measure loop flexibility at different temperatures

    • Glycine scanning mutagenesis to identify flexibility requirements

    • Chimeric constructs combining loops from mesophilic and thermophilic LspA to understand functional conservation

How does T. yellowstonii LspA potentially differ from LspA in mesophilic bacteria?

Several key differences would be expected when comparing T. yellowstonii LspA to mesophilic homologs:

  • Amino acid composition:

    • Higher percentage of charged amino acids (Arg, Glu, Lys) forming stabilizing salt bridges

    • Increased hydrophobic core packing through additional Val, Ile, and Leu residues

    • Potentially reduced glycine content in non-functional regions

  • Kinetic parameters:

    • Optimum activity at higher temperatures (likely 65-70°C)

    • Potentially lower activity at mesophilic temperatures (25-37°C)

    • Different Km and kcat values reflecting adaptation to thermophilic substrate states

  • Structural features:

    • Reduced length and number of surface loops

    • Additional stabilizing interactions in the transmembrane domains

    • Potentially altered membrane interaction due to differences in thermophilic membrane composition

  • Inhibitor sensitivity:

    • Potentially different sensitivity to globomycin and myxovirescin due to structural adaptations

    • Altered binding kinetics at different temperatures

What can be learned by comparing LspA across thermophilic species from different phyla?

Comparative analysis of LspA from diverse thermophilic bacteria would provide valuable insights:

  • Convergent evolution: Identification of similar thermostability adaptations that evolved independently in different bacterial lineages.

  • Phylum-specific adaptations: Distinctions between thermophilic adaptations in Nitrospirae (T. yellowstonii) versus other phyla such as Thermotogae or Aquificae.

  • Temperature range correlations: Correlation between optimal growth temperature and specific protein features across species.

  • Substrate diversity: How substrate specificity might vary between thermophilic species with different metabolic capabilities.

  • Evolutionary insights: Understanding whether thermophilic LspA evolved from mesophilic ancestors or if thermophily is an ancestral trait in some lineages.

How can knowledge about T. yellowstonii LspA contribute to understanding bacterial lipoprotein processing in extreme environments?

Research on T. yellowstonii LspA would expand our understanding of bacterial adaptation in several ways:

  • Extremophile adaptation: Insights into how essential cellular processes maintain function under extreme conditions.

  • Evolutionary plasticity: Understanding the degree of conservation versus adaptation in fundamental bacterial processes across diverse environments.

  • Biotechnological applications: Potential development of thermostable enzymes for biotechnological applications based on natural thermophilic adaptations.

  • Fundamental biochemistry: Broadening our understanding of the physical and chemical principles that govern protein stability and function across temperature ranges.

  • Comparative systems biology: Building more comprehensive models of how entire cellular pathways adapt to extreme conditions by comparing complete lipoprotein processing pathways across thermophilic and mesophilic bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.