Recombinant Thermodesulfovibrio yellowstonii NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Functional Role in the NADH-Quinone Oxidoreductase Complex

NuoK is integral to the NDH-1 complex, which couples NADH oxidation to quinone reduction and proton pumping. In Thermodesulfovibrio, genomic analysis reveals NDH-1 clusters lacking NuoEFG subunits, suggesting alternative electron donors (e.g., reduced ferredoxin from pyruvate:ferredoxin oxidoreductase) .

Key Functional Insights

  • Electron Transfer: NuoK interacts with other subunits (e.g., NuoB, NuoI) to stabilize the quinone-binding site and facilitate electron flow .

  • Proton Translocation: While NuoK itself is hydrophilic, it associates with membrane-embedded subunits (NuoL, NuoM, NuoN) that pump protons .

  • Adaptation to Thermophily: Thermodesulfovibrio’s NDH-1 is optimized for high-temperature environments, with structural features enabling stability at 65°C .

Production and Purification

The recombinant nuoK is produced via heterologous expression in E. coli, leveraging the organism’s robust protein synthesis machinery. Critical steps include:

StepDetails
Expression SystemE. coli (strain unspecified)
PurificationNickel affinity chromatography (due to His-tag)
Quality ControlSDS-PAGE (>90% purity) , ELISA validation (for antibody production)
Storage ConditionsLyophilized powder at -20°C/-80°C; avoid repeated freeze-thaw cycles

Enzyme Activity Studies

Mutagenesis studies in Salmonella highlight how subunit mutations (e.g., nuoG, nuoM, nuoN) alter NDH-1 activity. While nuoK itself has not been directly mutated in Thermodesulfovibrio, its homologs in other bacteria show that subunit interactions critically affect quinone binding and proton translocation .

Diagnostic Tools

ELISA kits incorporating recombinant nuoK enable detection of anti-Thermodesulfovibrio antibodies, aiding microbial community analysis in extreme environments .

Genomic Context and Evolutionary Significance

Thermodesulfovibrio genomes encode NDH-1 clusters linked to sulfur metabolism (e.g., thiosulfate reductases) . NuoK’s presence in all Thermodesulfovibrio species (e.g., T. yellowstonii, T. islandicus) underscores its conserved role in respiratory pathways, particularly in sulfate-reducing, thermophilic ecosystems .

Challenges and Future Directions

  • Structural Elucidation: High-resolution crystallography of Thermodesulfovibrio NDH-1 remains unreported, limiting mechanistic insights.

  • Functional Redundancy: The absence of NuoEFG subunits in Thermodesulfovibrio NDH-1 raises questions about alternative electron donors and regulatory mechanisms .

  • Ecological Relevance: Field studies using recombinant nuoK in ELISAs could map Thermodesulfovibrio’s distribution in hydrothermal vents and subsurface environments .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoK; THEYE_A0918; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Target Names
nuoK
Target Protein Sequence
MIPLSWYLLLSATLFSIGLIGFVIRRDLIVMLMCLEIMFNAVNIAFASFSYYNSNLTGQI FVLFSIAVAACEAVIGLAIVLALVRNTGINHSDEIVNLRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled to proton translocation; four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Thermodesulfovibrio yellowstonii and where was it isolated?

Thermodesulfovibrio yellowstonii is a thermophilic sulfate-reducing bacterium isolated from thermal vent water in Yellowstone Lake, Wyoming, USA. It is characterized as a gram-negative, curved rod-shaped bacterium with cells averaging 0.3 micrometers wide and 1.5 micrometers long. The organism is motile via a single polar flagellum and demonstrates growth between 40°C and 70°C, with optimal growth occurring at 65°C . Thermodesulfovibrio yellowstonii represents a distinct phylogenetic lineage that branches deeply within the Bacteria domain and differs from previously defined phylogenetic lines of sulfate-reducing bacteria .

What is the role of the nuoK subunit in NADH-quinone oxidoreductase?

The nuoK subunit (counterpart of the mitochondrial ND4L subunit) is one of seven hydrophobic subunits in the membrane domain of the bacterial H+-translocating NADH:quinone oxidoreductase (NDH-1). This enzyme catalyzes electron transfer from NADH to quinone coupled with proton pumping across the cytoplasmic membrane . The nuoK subunit contains three transmembrane segments (TM1-3) and plays a critical role in the energy transduction mechanism of NDH-1 . Research has demonstrated that conserved carboxyl residues within the nuoK transmembrane domains are essential for proper energy coupling and enzymatic function.

What electron acceptors does Thermodesulfovibrio yellowstonii utilize?

Thermodesulfovibrio yellowstonii can utilize sulfate, thiosulfate, and sulfite as electron acceptors. Notably, the organism does not reduce sulfur, fumarate, or nitrate. In the presence of sulfate, growth is observed only with specific electron donors: lactate, pyruvate, hydrogen plus acetate, or formate plus acetate . Pyruvate is the only compound that has been observed to support fermentative growth of this organism. The bacterium oxidizes pyruvate and lactate to acetate during its metabolic processes .

How can I optimize recombinant expression of Thermodesulfovibrio yellowstonii nuoK in E. coli?

For optimal recombinant expression of Thermodesulfovibrio yellowstonii nuoK in E. coli, a systematic approach addressing temperature, induction conditions, and growth parameters is recommended:

  • Culture initiation: Inoculate an overnight bacterial culture into Luria-Bertani (LB) medium (10 g/L tryptone, 5 g/L yeast extract, and 10 g/L NaCl) at 37°C for 10 hours .

  • Growth conditions: Dilute the culture (1:10) in fresh LB medium containing appropriate antibiotic (50 μg/ml kanamycin for plasmids with kanamycin resistance) .

  • Temperature optimization: For thermophilic proteins like nuoK from T. yellowstonii, test expression at different temperatures. Initial growth at 37°C for 4 hours followed by induction at lower temperatures (17°C, 27°C, or 37°C) should be evaluated to determine optimal conditions .

  • Induction parameters: Add 0.8 mM isopropyl β-d-1-thiogalactopyranoside (IPTG) to induce protein expression after the initial growth period. Test various induction durations (4, 6, and 8 hours) to identify optimal expression time .

  • Expression verification: Analyze protein expression using SDS-PAGE and Western blotting to confirm successful production of the recombinant nuoK protein.

The combination of induction at 17°C for 4 hours after initial growth at 27°C has shown promising results for recombinant protein expression in similar systems .

What methods can be used to assess the activity of recombinant nuoK in NADH-quinone oxidoreductase complexes?

Activity assessment of recombinant nuoK in NADH-quinone oxidoreductase complexes should be approached through multiple complementary assays:

  • Electron transfer activity measurements:

    • dNADH-K3Fe(CN)6 reductase activity: Perform at 30°C with 80 μg protein/ml in 10 mM potassium phosphate (pH 7.0), 1 mM EDTA containing 10 mM KCN, and 1 mM K3Fe(CN)6. Preincubate samples for 1 minute before initiating the reaction with 150 μM dNADH. Monitor the signal at 420 nm .

    • dNADH-DB reductase activity: Replace K3Fe(CN)6 with 50 μM DB (decylubiquinone) as the electron acceptor and monitor the signal at 340 nm in the same buffer .

    • dNADH-UQ1 reductase activity: Use 50 μM UQ1 (ubiquinone-1) and measure at 340 nm. Capsaicin-40 can be added to inhibit the reaction for control measurements .

  • Proton pumping assay: Monitor NDH-1 proton pump activity via ACMA (9-amino-6-chloro-2-methoxyacridine) fluorescence quenching using 200 μM dNADH as the substrate .

  • pH-dependent activity analysis: Measure dNADH oxidase, dNADH-DB, and dNADH-UQ1 reductase activities at various pH values to determine the pH optimum and assess the functional role of key residues in proton translocation .

For calculation of enzyme activities, use extinction coefficients of ε340 = 6.22 mM−1 cm−1 for dNADH and ε420 = 1.00 mM−1 cm−1 for K3Fe(CN)6 .

How should RNA be isolated for transcriptomic analysis of recombinant nuoK expression?

For high-quality RNA isolation from bacterial cultures expressing recombinant nuoK:

  • Culture preparation: Incubate cells under standardized conditions (e.g., 15 rpm, 27°C for 4 hours) followed by IPTG induction at 17°C for 4 hours .

  • RNA extraction: Extract total RNA using a commercial RNA isolation system (such as Roche RNA isolation kit) .

  • DNA removal: Treat samples with DNaseI to eliminate genomic DNA contamination that could interfere with downstream analyses .

  • Quality assessment: Evaluate RNA quality using spectrophotometric analysis (NanoDrop 2000c or equivalent) to ensure sufficient purity and concentration .

  • Sequencing preparation: For transcriptomic analysis, prepare the RNA for sequencing using platform-appropriate protocols. For Solexa Genome Analyzer sequencing, follow the manufacturer's recommended library preparation methods .

  • Data analysis: Calculate gene expression levels using the transcripts per million (TPM) method. Process raw reads (truncating 35 bp reads to 28-mers if necessary) and map to the reference genome allowing for 1-2 nucleotide mismatches. Analyze output files containing uniquely mapped sequences to determine genome coverage and assign read counts to each locus .

This methodology ensures high-quality RNA for accurate transcriptomic profiling of nuoK expression and related genes.

How do specific mutations in conserved residues affect nuoK function in proton translocation?

Research on the nuoK subunit has identified key residues crucial for proton translocation and energy transduction:

MutationLocationEffect on NDH-1 ActivityProposed Mechanism
E36A/E36QTM2Almost complete loss of energy transducing activitiesCritical for proton translocation pathway
E72A/E72QTM3Partial but significant loss of activitiesSecondary role in proton translocation
Position shifts of E36 (to 32, 38, 39, 40)TM2Largely retained energy transducing activitiesFunctional when in same helix phase
R25/R26 mutationsLoop-1 (cytoplasmic)Drastic effect on energy transducing activitiesImportant for structural integrity and function

The two glutamic acid residues (KGlu-36 and KGlu-72) located in adjacent transmembrane helices play critical roles in the energy coupling mechanism of NDH-1 . Mutation of the highly conserved KGlu-36 to alanine results in complete loss of NDH-1 activities, while mutation of KGlu-72 causes a moderate reduction in activity .

Interestingly, relocating KGlu-36 along TM2 to positions 32, 38, 39, and 40 results in mutants that largely retain energy transducing activities. This suggests that the precise position is less critical than maintaining the residue within the same helix phase or within an immediately adjacent helix turn .

Additionally, two arginine residues (KArg-25 and KArg-26) in the cytoplasmic loop connecting TM1 and TM2 (loop-1) are essential for proper energy transduction, indicating that both the transmembrane domains and connecting loops contribute to the functional mechanism of proton translocation .

What is the evolutionary relationship between Thermodesulfovibrio yellowstonii nuoK and related proteins in other organisms?

The evolutionary analysis of Thermodesulfovibrio yellowstonii nuoK reveals significant insights into the diversification of respiratory chain components:

This evolutionary context provides valuable insights for researchers studying the structure-function relationships of respiratory chain complexes across different species.

How can I incorporate nuoK sequence data into multi-omics analysis for understanding respiratory chain complex assembly?

Integrating nuoK sequence data into a comprehensive multi-omics analysis requires strategic approaches across genomic, transcriptomic, and proteomic levels:

  • Genomic analysis:

    • Perform comparative genomic analysis of nuoK and flanking genes across related species

    • Identify conserved regulatory elements in the promoter region that may control expression

    • Analyze codon usage patterns to optimize heterologous expression

  • Transcriptomic analysis:

    • Generate expression data using RNA sequencing as described earlier

    • Calculate transcripts per million (TPM) to quantify expression levels

    • Map reads to the genome allowing for 1-2 nucleotide mismatches for accurate assignment

    • Analyze co-expression patterns of nuoK with other respiratory complex subunits

  • Proteomic verification:

    • Use liquid chromatography-mass spectrometry (LC-MS/MS) to identify and quantify nuoK and interacting proteins

    • Apply blue native polyacrylamide gel electrophoresis (BN-PAGE) to analyze intact respiratory complexes

    • Perform cross-linking studies to identify protein-protein interactions within the complex

  • Structural biology integration:

    • Map sequence variations onto structural models to identify functionally important regions

    • Use the known transmembrane topology (three transmembrane segments in nuoK) to predict interaction surfaces

    • Correlate conserved residues (KGlu-36, KGlu-72) with structural features that may be involved in proton translocation

  • Data integration strategies:

    • Apply statistical methods to correlate findings across different omics platforms

    • Use pathway enrichment analysis to identify biological processes associated with nuoK function

    • Develop predictive models for complex assembly based on integrated datasets

This multi-omics approach provides a comprehensive understanding of how nuoK contributes to respiratory chain complex assembly and function at multiple biological levels.

What are common challenges in expressing thermophilic proteins in mesophilic hosts and how can they be addressed?

Expressing thermophilic proteins like those from Thermodesulfovibrio yellowstonii in mesophilic hosts such as E. coli presents several challenges and solutions:

ChallengeCauseSolution Strategies
Poor protein foldingTemperature mismatch between thermophilic protein and mesophilic hostUse lower induction temperatures (17-27°C) ; Add compatible solutes; Co-express chaperones
Low expression levelsCodon bias differences; Toxicity to hostOptimize codon usage for E. coli; Use tunable promoters; Express in cell-free systems
Protein insolubilityHydrophobic protein regions (nuoK has 3 transmembrane domains) Express with solubility tags (MBP, SUMO); Use specialized membrane protein expression strains
Protein instabilityProteolytic degradationUse protease-deficient host strains; Include protease inhibitors during purification
Loss of functionImproper post-translational modifications or cofactor incorporationSupplement growth media with specific cofactors; Co-express partner proteins

Temperature optimization is particularly critical for thermophilic proteins. While T. yellowstonii grows optimally at 65°C , expression of its proteins in E. coli typically requires significantly lower temperatures. The optimal strategy often involves initial growth at 37°C followed by induction at lower temperatures (17-27°C) to slow protein synthesis and allow proper folding .

For membrane proteins like nuoK with multiple transmembrane segments , expression in the correctly folded form presents additional challenges. Consider using specialized expression systems designed for membrane proteins, such as C41(DE3) or C43(DE3) E. coli strains, which are better adapted for membrane protein expression.

How can I differentiate between direct effects of nuoK mutations and indirect effects on complex assembly?

Distinguishing direct functional effects of nuoK mutations from indirect effects on complex assembly requires a multi-faceted experimental approach:

  • Complex integrity assessment:

    • Use blue native PAGE to analyze intact complex formation

    • Perform sucrose gradient ultracentrifugation to isolate intact complexes

    • Apply size exclusion chromatography to assess complex stability

    • Quantify subunit stoichiometry using mass spectrometry

  • Localized proton translocation assays:

    • Use pH-sensitive fluorescent dyes to monitor localized pH changes

    • Employ reconstituted proteoliposome systems with purified complexes

    • Measure proton pumping activity (ACMA fluorescence quenching) in membrane vesicles

    • Compare electron transfer rates (dNADH-K3Fe(CN)6, dNADH-DB, dNADH-UQ1 reductase activities) with proton pumping efficiency

  • Mutation-specific analyses:

    • Create strategic mutations that specifically affect function without altering structure (e.g., conservative substitutions)

    • Test positional variants of key residues (as done with KGlu-36 relocations to positions 32, 38, 39, and 40)

    • Use double and complementary mutations to confirm direct mechanistic roles

  • Structural characterization:

    • Apply cryo-electron microscopy to determine structural integrity of mutant complexes

    • Use cross-linking mass spectrometry to map interaction interfaces

    • Perform hydrogen-deuterium exchange mass spectrometry to assess conformational dynamics

By implementing this comprehensive approach, researchers can confidently differentiate between mutations that directly affect nuoK's functional role in proton translocation versus those that primarily disrupt complex assembly or stability.

What gene expression data analysis methods are most appropriate for nuoK studies in different experimental contexts?

Different experimental contexts in nuoK research require tailored gene expression analysis methods:

  • Differential expression analysis in recombinant systems:

    • RNA-Seq approach: Generate sequencing data and calculate expression using transcripts per million (TPM)

    • Data processing: Truncate raw reads as needed (e.g., 35 bp to 28-mers) and map to reference genome allowing 1-2 nucleotide mismatches

    • Statistical analysis: Apply DESeq2 or edgeR to identify statistically significant expression changes

    • Validation: Confirm key findings with RT-qPCR using gene-specific primers

  • Native expression analysis in T. yellowstonii:

    • Growth conditions: Culture at optimal thermophilic conditions (65°C)

    • RNA preservation: Use specialized high-temperature RNA preservation methods

    • Normalization: Select appropriate reference genes stable under thermophilic conditions

    • Data interpretation: Account for growth rate differences at various temperatures

  • Co-expression network analysis:

    • Correlation methods: Apply Pearson or Spearman correlation to identify genes with similar expression patterns

    • Network construction: Build gene co-expression networks to identify functional modules

    • Enrichment analysis: Perform pathway enrichment to determine biological processes associated with nuoK expression

    • Visualization: Use tools like Cytoscape to visualize gene networks

  • Single-cell transcriptomics (for heterogeneous populations):

    • Cell isolation: Use fluorescence-activated cell sorting (FACS) to isolate specific cell populations

    • Low-input RNA processing: Apply methods optimized for small RNA quantities

    • Dimensionality reduction: Implement t-SNE or UMAP to visualize cell populations

    • Trajectory analysis: Use pseudotime analysis to track expression changes

When analyzing gene expression data, researchers should follow established guidelines for quality control, normalization, and statistical analysis as outlined in gene expression data analysis frameworks . For thermal adaptation studies specific to T. yellowstonii, additional considerations for RNA stability at different temperatures should be incorporated into the experimental design and data interpretation.

How might CRISPR-Cas9 genome editing be applied to study nuoK function in Thermodesulfovibrio yellowstonii?

Applying CRISPR-Cas9 genome editing to study nuoK function in Thermodesulfovibrio yellowstonii represents a challenging but potentially transformative approach:

  • System adaptation for thermophilic conditions:

    • Identify thermostable Cas9 variants or orthologs from thermophilic organisms

    • Design guide RNAs with higher GC content for stability at elevated temperatures

    • Optimize transformation protocols for T. yellowstonii growing at 65°C

    • Develop selectable markers functional at thermophilic growth temperatures

  • Target modifications for nuoK functional analysis:

    • Create precise point mutations in conserved residues (KGlu-36, KGlu-72)

    • Generate domain swaps with related proteins to identify functional regions

    • Introduce epitope tags for in situ localization and interaction studies

    • Establish inducible expression systems for conditional knockdown/knockout

  • Phenotypic assays for edited strains:

    • Measure growth rates under different electron acceptor conditions

    • Quantify proton translocation efficiency in intact cells

    • Assess respiratory complex assembly and stability

    • Determine thermotolerance profiles of mutant strains

  • Integration with other techniques:

    • Combine with RNA-Seq to assess global transcriptional responses to nuoK modifications

    • Pair with metabolomic analysis to identify downstream metabolic effects

    • Implement with structural studies to correlate sequence to function

This approach would overcome current limitations in genetic manipulation of thermophilic bacteria and provide unprecedented insights into the function of nuoK in its native context. The development of such tools would also benefit the broader field of extremophile biology and biotechnology.

What opportunities exist for applying structural biology techniques to nuoK research?

Structural biology offers significant opportunities for advancing nuoK research through multiple complementary approaches:

  • Cryo-electron microscopy (cryo-EM):

    • Determine high-resolution structures of intact NDH-1 complexes containing nuoK

    • Visualize different conformational states during the catalytic cycle

    • Identify the precise arrangement of transmembrane helices and their interactions

    • Map the locations of critical residues (KGlu-36, KGlu-72) within the proton translocation pathway

  • X-ray crystallography:

    • Attempt crystallization of the membrane domain containing nuoK

    • Use antibody-mediated crystallization to stabilize flexible regions

    • Employ lipidic cubic phase techniques for membrane protein crystallization

    • Generate constructs with thermostable fusion partners to enhance crystallization propensity

  • NMR spectroscopy:

    • Perform solution NMR on isolated domains or synthetic peptides representing transmembrane segments

    • Apply solid-state NMR to study nuoK in membrane environments

    • Measure dynamics and conformational changes upon substrate binding or pH changes

    • Study proton exchange rates to identify residues involved in proton translocation

  • Computational structural biology:

    • Develop accurate homology models based on related structures

    • Perform molecular dynamics simulations at elevated temperatures to mimic thermophilic conditions

    • Model proton translocation pathways through nuoK and adjacent subunits

    • Predict effects of mutations on structure and function

  • Integrative structural approaches:

    • Combine low-resolution cryo-EM maps with computational modeling

    • Use cross-linking mass spectrometry to define subunit interfaces

    • Apply hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

    • Implement small-angle X-ray scattering (SAXS) for solution structure validation

These structural approaches would provide crucial insights into how the three transmembrane segments of nuoK participate in proton translocation and energy coupling within the larger respiratory complex.

How can systems biology approaches integrate nuoK function with broader cellular metabolism in thermophilic bacteria?

Systems biology approaches offer powerful frameworks for integrating nuoK function with broader cellular metabolism in thermophilic bacteria:

  • Genome-scale metabolic modeling:

    • Construct a genome-scale metabolic model of T. yellowstonii

    • Incorporate respiratory chain components including nuoK

    • Simulate metabolic fluxes under different electron acceptor conditions (sulfate, thiosulfate, sulfite)

    • Predict growth phenotypes of nuoK mutants and validate experimentally

  • Multi-omics data integration:

    • Correlate transcriptomic, proteomic, and metabolomic data across growth conditions

    • Apply network analysis to identify key regulatory nodes connecting respiratory function to central metabolism

    • Develop machine learning models to predict metabolic responses to respiratory chain perturbations

    • Implement flux balance analysis to quantify metabolic shifts in response to nuoK modifications

  • Comparative systems analysis:

    • Compare metabolic network architecture across thermophilic and mesophilic sulfate-reducing bacteria

    • Identify conserved and divergent regulatory mechanisms controlling respiratory complex expression

    • Analyze evolutionary patterns in the integration of respiratory and metabolic systems

    • Examine the relationship between optimal growth temperature and respiratory chain composition

  • Synthetic biology applications:

    • Design minimal respiratory modules containing nuoK for heterologous expression

    • Develop biosensors based on nuoK function to monitor cellular energetics

    • Engineer thermostable electron transport chains incorporating optimized nuoK variants

    • Create hybrid systems combining components from different thermophilic organisms

This systems-level understanding would provide insights into how thermophilic organisms like T. yellowstonii integrate electron transport, energy conservation, and central metabolism under extreme temperature conditions. Additionally, it could reveal design principles for engineering thermostable respiratory systems for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.