Recombinant Thermofilum pendens Digeranylgeranylglyceryl phosphate synthase (Tpen_1449)

Shipped with Ice Packs
In Stock

Description

Overview and Genomic Context

Tpen_1449 is a gene encoding digeranylgeranylglyceryl phosphate synthase, a critical enzyme in the biosynthesis of archaeal membrane lipids. This enzyme is part of the lipid metabolism machinery in Thermofilum pendens, a hyperthermophilic crenarchaeon isolated from geothermal environments. The genome of T. pendens (2.1 Mb) reveals extensive adaptations to nutrient-rich, anaerobic habitats, including a reduced biosynthetic capacity but retained pathways for lipid synthesis .

Tpen_1449 is located in a genomic region associated with isoprenoid biosynthesis and glycerol-1-phosphate (G1P) modification. Its locus tag (Tpen_1449) corresponds to a 1,335-bp open reading frame encoding a 445-amino-acid protein .

Enzymatic Function and Pathway Role

The enzyme catalyzes the transfer of geranylgeranyl groups to glyceryl phosphate, forming digeranylgeranylglyceryl phosphate, a precursor to archaeal phospholipids. Key features include:

PropertyDetail
Reaction CatalyzedTransfer of two geranylgeranyl groups to sn-glycerol-1-phosphate
CofactorsMg²⁺ or Mn²⁺ (predicted based on homologs)
Subcellular LocalizationMembrane-associated (inferred from lipid biosynthesis role)
HomologsShares homology with geranylgeranyltransferases in Methanocaldococcus spp.

This enzyme operates in conjunction with:

  • Tpen_0633 and Tpen_0636: Additional geranylgeranyltransferases .

  • Tpen_1231: sn-glycerol-1-phosphate dehydrogenase, which generates G1P .

Genomic and Metabolic Network

Tpen_1449 is part of a streamlined lipid biosynthesis pathway in T. pendens:

  1. Isoprenoid Precursors: Generated via a modified mevalonate pathway (e.g., Tpen_0607, an isopentenyl phosphate kinase) .

  2. G1P Backbone: Synthesized by Tpen_1231.

  3. Geranylgeranyl Donors: Produced by Tpen_0606 (geranylgeranyl diphosphate synthase).

Notably, T. pendens lacks pathways for fatty acid synthesis, relying entirely on ether-linked isoprenoid lipids for membrane stability .

Research Implications and Applications

  • Biotechnology: Potential use in synthesizing thermostable archaeal lipids for drug delivery systems or extremophile-inspired membranes.

  • Evolutionary Significance: Highlights conserved lipid adaptations in anaerobic, hyperthermophilic archaea.

  • Unresolved Questions:

    • Kinetic parameters under varying temperatures.

    • Structural confirmation via X-ray crystallography.

Critical Data Gaps and Future Directions

Current knowledge is limited to genomic predictions. Key priorities for recombinant studies include:

  • Heterologous expression in E. coli or Sulfolobus systems.

  • Functional assays to confirm prenyltransferase activity.

  • Comparative analysis with homologs from Methanogens or Thermococcales.

This enzyme exemplifies T. pendens’ metabolic specialization in energy-limited, high-temperature environments, prioritizing lipid remodeling over de novo biosynthesis .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tpen_1449; Digeranylgeranylglyceryl phosphate synthase; DGGGP synthase; DGGGPS; (S-2,3-di-O-geranylgeranylglyceryl phosphate synthase; Geranylgeranylglycerol-phosphate geranylgeranyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Thermofilum pendens (strain DSM 2475 / Hrk 5)
Target Names
Tpen_1449
Target Protein Sequence
MKSSLPGALFQRVADWLRLLRAGNCAVVSLGAYTGYVAGRGGSLPQGVLVAASAALVAAW GNIVNDYFDLESDAISKPWRPLPSRRISPGSAVSASLPLLAAGLALGFLVSPLCGFTAVL ASALLFLYSWRVKALGLPGNVLIAFLAALNVVYGALASPEPWRSLLPSAYAFLIILGREV LKGVEDLEGDAARGVKTVASTLGARAALRVSAVLLLAVVALSPLPLLSGYGALYALFAFG GVDAPIALALLKAGPEPRRAWIATRILKVPLLMGLLAFLVGGLA
Uniprot No.

Target Background

Function
Recombinant *Thermofilum pendens* Digeranylgeranylglyceryl phosphate synthase (Tpen_1449) is a prenyltransferase. It catalyzes the transfer of the geranylgeranyl moiety from geranylgeranyl diphosphate (GGPP) to the C2 hydroxyl group of (S)-3-O-geranylgeranylglyceryl phosphate (GGGP). This reaction represents the second ether bond formation step in archaeal membrane lipid biosynthesis.
Database Links
Protein Families
UbiA prenyltransferase family, DGGGP synthase subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.