Recombinant Thermofilum pendens UPF0290 protein Tpen_0433 (Tpen_0433)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics

Molecular identity:

  • Gene locus: Tpen_0433 (ordered locus name)

  • UniProt ID: A1RXB2

  • Sequence: 204-amino acid full-length protein with predicted twin-arginine signal peptide (MRISVYACFLGLYFLVFSLIVYVILGAEFLVSVLQPGNVARSmLWVLPAYVANASPVVFS...)

Genomic insights:

  • Located in a genome with extreme metabolic auxotrophy: Lacks pathways for purine, amino acid, and cofactor biosynthesis, relying on environmental nutrients .

  • Co-occurs with genes for ABC transporters and CRISPR-associated proteins, suggesting roles in nutrient uptake or stress response .

Functional hypotheses:

  • Carbohydrate metabolism: T. pendens has enhanced carbohydrate transporters (e.g., phosphotransferase systems), but Tpen_0433’s direct role remains unconfirmed .

  • Membrane biogenesis: Linked to glycosyltransferases and lipid-modifying enzymes in genomic analyses .

Research Applications

Experimental utility:

  • Used to study extremophile protein stability (optimal activity at >80°C) .

  • Potential marker for investigating archaeal commensalism in geothermal ecosystems .

Comparative Genomics

UPF0290 family distribution:

OrganismHomolog IDFunctional Annotation
Staphylothermus marinusSmar_0617Hypothetical protein
Hyperthermus butylicusHbut_1639Uncharacterized membrane protein

Distinctive traits in T. pendens:

  • CRISPR-associated proteins dominate highly expressed genes, implying viral defense prioritization .

  • Lacks biosynthetic pathways but retains transporters for peptides and carbohydrates .

Unresolved Questions and Future Directions

  • Functional elucidation: No experimental data exist on enzymatic activity or substrate specificity .

  • Ecological role: Potential involvement in interspecies nutrient exchange in geothermal microbial communities .

  • Structural studies: High-resolution crystallography needed to resolve membrane interaction mechanisms .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as an additional fee will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
carS; Tpen_0433; CDP-archaeol synthase; CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Thermofilum pendens (strain DSM 2475 / Hrk 5)
Target Names
carS
Target Protein Sequence
MRISVYACFLGLYFLVFSLIVYVILGAEFLVSVLQPGNVARSMLWVLPAYVANASPVVFS RLVRKRWRLHPMDFGLTFVDGQRLLGDNKTFEGFLGGMLSGVLVGILLAYARFVDGVSAF LLPLGALLGDLGGAFVKRRLRIKPGEPAILLDQLDFVAGALILQGLFSKLPAAEVVVAVV LLTPIVHLLTNMAAFVLGLKDVPW
Uniprot No.

Target Background

Function
This enzyme catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction represents the third ether-bond-formation step in the biosynthesis of archaeal membrane lipids.
Database Links
Protein Families
CDP-archaeol synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of Tpen_0433 in Thermofilum pendens?

Tpen_0433 is encoded within the complete genome of Thermofilum pendens, a deeply branching hyperthermophilic member of the archaeal kingdom Crenarchaeota. The genomic context analysis is crucial for understanding potential functional associations of this protein. To analyze the genomic context:

  • Extract the complete genome sequence of T. pendens from public databases

  • Identify the precise location of the Tpen_0433 gene

  • Analyze flanking regions (approximately 10 kb upstream and downstream)

  • Identify nearby genes, especially those in potential operons with Tpen_0433

  • Compare synteny with related archaeal genomes

This contextual analysis reveals that while T. pendens has a reduced biosynthetic capacity, requiring an extract of Thermoproteus tenax for growth and lacking pathways for purines, most amino acids, and cofactors, the genomic neighborhood of Tpen_0433 may provide clues to its functional role within these constraints .

What expression systems are most suitable for recombinant production of Tpen_0433?

The expression of archaeal proteins, particularly from hyperthermophiles like T. pendens, presents unique challenges due to differences in translational machinery and folding requirements. The recommended expression approaches are:

Table 1: Expression Systems for Recombinant Tpen_0433 Production

Expression SystemAdvantagesLimitationsOptimal Conditions
E. coli BL21(DE3)High yield, simple protocolsPotential misfoldingIPTG 0.1-0.5 mM, 18-25°C induction
E. coli RosettaEnhanced rare codon translationModerate yieldIPTG 0.2 mM, 30°C induction
Sulfolobus spp.Native-like folding environmentComplex cultivation75-80°C, pH 3.0-3.5, specialized media
Cell-free systemAvoids toxicity issuesLower yield30-37°C, archaeal ribosomes recommended

When expressing Tpen_0433, consider that T. pendens is an anaerobic, sulfur-dependent hyperthermophile isolated from solfataras in Iceland, with growth optimal at extremely high temperatures. The protein likely requires specific conditions for proper folding and activity that mimic its native environment .

What purification strategy should be employed for Tpen_0433?

Purifying recombinant Tpen_0433 requires a tailored approach considering the thermostable nature of proteins from T. pendens. A recommended purification protocol is:

  • Heat treatment (70-80°C for 20 minutes) as an initial purification step, taking advantage of the thermostability of Tpen_0433 while denaturing most host proteins

  • Immobilized metal affinity chromatography (IMAC) using a His-tag

  • Size exclusion chromatography for final polishing

  • Buffer optimization containing stabilizing agents (consider including extract from T. tenax if available, as T. pendens requires this for growth)

Monitor purification using SDS-PAGE and Western blotting. For structural studies, additional purification steps may be required to achieve >95% purity.

How should researchers assess the thermostability of purified Tpen_0433?

Given the hyperthermophilic nature of T. pendens, characterizing the thermostability of Tpen_0433 is essential. Recommended methodological approaches include:

  • Differential Scanning Calorimetry (DSC) to determine melting temperature (Tm), typically expected between 80-100°C for proteins from hyperthermophiles

  • Circular Dichroism (CD) spectroscopy with temperature ramping to monitor structural changes

  • Activity assays (once function is established) at various temperatures (60-100°C)

  • Thermal shift assays using fluorescent dyes

These methods should be conducted in buffers mimicking the native environment of T. pendens, considering its adaptation to solfataras in Iceland with high temperature and specific ionic conditions .

What structural features contribute to the thermostability of Tpen_0433 and how can they be experimentally verified?

The thermostability of Tpen_0433, like other proteins from hyperthermophiles, likely results from specific structural adaptations. Advanced experimental approaches to characterize these features include:

  • X-ray crystallography at multiple temperatures to observe temperature-dependent conformational changes

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions with reduced flexibility

  • Site-directed mutagenesis of predicted stabilizing elements (salt bridges, disulfide bonds, hydrophobic cores)

  • Molecular dynamics simulations at elevated temperatures (80-100°C)

Table 2: Predicted Thermostabilizing Features in Tpen_0433

Stabilizing FeaturePrediction MethodExperimental VerificationExpected Impact
Salt bridgesElectrostatic analysisMutagenesis of charged residuesDecreased Tm after disruption
Compacted hydrophobic coreHydrophobicity analysisFluorescence spectroscopyReduced ANS binding
Disulfide bondsCysteine proximity analysisNon-reducing SDS-PAGEMigration differences
Proline contentSequence analysisProline-to-alanine mutationsFlexibility changes in CD spectra

These approaches should consider that T. pendens has adapted to life in solfataras with extreme conditions, and its proteins have evolved specific mechanisms to maintain structural integrity at high temperatures .

How can function be assigned to Tpen_0433 using comparative genomics and biochemical approaches?

As a member of the UPF0290 family of uncharacterized proteins, determining the function of Tpen_0433 requires an integrated approach:

  • Comprehensive phylogenetic analysis across archaea and bacteria containing UPF0290 proteins

  • Structural modeling and comparison with proteins of known function

  • Gene neighborhood analysis across multiple genomes

  • Metabolic reconstruction considering the heterotrophic lifestyle of T. pendens

  • Activity screening assays including:

    • Nuclease activity (DNA/RNA binding and cleavage)

    • Interaction with sulfur compounds (given the sulfur dependency of T. pendens)

    • Enzyme activity tests with various substrates relevant to T. pendens metabolism

Consider that T. pendens utilizes peptides and carbohydrates for energy and may obtain energy from sulfur reduction with hydrogen and formate as electron donors. Tpen_0433 may play a role in these metabolic pathways or in adaptation to the commensal lifestyle, as T. pendens requires an extract of Thermoproteus tenax for growth .

What is the subcellular localization of Tpen_0433 and how does it relate to function?

Understanding the subcellular localization of Tpen_0433 provides crucial insights into its function. Advanced methodological approaches include:

  • Immunogold electron microscopy using antibodies against purified Tpen_0433

  • Fractionation of T. pendens cells followed by Western blotting

  • Fluorescent protein fusions (if a genetic system for T. pendens exists)

  • Computational prediction using specialized archaeal localization algorithms

Interpretation of results should consider that T. pendens forms long thin filaments with spherical bulges at one end that may relate to its reproduction mode. Additionally, subcellular localization patterns may provide clues about potential involvement in sulfur metabolism, peptide utilization, or interaction with T. tenax .

How does Tpen_0433 interact with other proteins in the T. pendens proteome?

Investigating the protein-protein interaction network of Tpen_0433 can reveal functional associations. Advanced methodological approaches include:

  • Pull-down assays using recombinant His-tagged Tpen_0433 and T. pendens lysate

  • Yeast two-hybrid screening with a T. pendens genomic library

  • Crosslinking mass spectrometry (XL-MS) to capture transient interactions

  • Bacterial/archaeal two-hybrid systems adapted for high temperature

Table 3: Potential Protein Interaction Partners Based on Genomic Context Analysis

Protein CategoryPrediction BasisExperimental ApproachFunctional Implication
Sulfur metabolism proteinsT. pendens sulfur dependencyCo-immunoprecipitation with anti-Tpen_0433 antibodiesRole in energy generation
Carbohydrate transportersExpanded carbohydrate utilization in T. pendensBacterial two-hybrid screeningNutrient acquisition
CRISPR-associated proteinsHigh expression of CRISPR systems in T. pendensPull-down assaysViral defense
T. tenax extract componentsCommensal requirementCross-species pull-downGrowth dependency

Consider that T. pendens has fewer biosynthetic enzymes than obligate intracellular parasites but does not display other parasitic features. The interaction network may reveal how Tpen_0433 contributes to adaptation to a nutrient-rich environment .

How does Tpen_0433 expression respond to environmental stressors?

As a hyperthermophilic archaeon adapted to extreme conditions, understanding how Tpen_0433 expression responds to environmental changes provides insights into its physiological role. Advanced methodological approaches include:

  • RNA-Seq analysis of T. pendens under various stress conditions:

    • Temperature variation (optimal vs. suboptimal)

    • Sulfur limitation

    • Presence/absence of T. tenax extract

    • Oxidative stress

  • Quantitative proteomics to correlate transcript and protein levels

  • Promoter analysis using reporter systems (if genetic tools are available)

  • ChIP-Seq to identify transcription factors regulating Tpen_0433

When designing these experiments, consider that T. pendens has adaptations for life in an environment rich in nutrients and may have regulatory mechanisms related to its commensal relationship with T. tenax .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.