Recombinant Thermoplasma acidophilum Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant cobS

Recombinant cobS is produced by expressing the cobS gene (locus Ta1079) from T. acidophilum in Escherichia coli, fused with an N-terminal His tag for purification . The protein corresponds to residues 1–255 (UniProt ID: Q9HJ91) and plays a role in the final steps of cobalamin synthesis, likely facilitating cobalt insertion or peripheral amidation .

PropertyDetail
OrganismThermoplasma acidophilum (strain ATCC 25905 / DSM 1728)
Molecular Weight~29–31 kDa (predicted)
TagN-terminal His tag
Expression SystemE. coli
StorageTris-based buffer with 50% glycerol; stable at -20°C or -80°C

Genomic and Functional Context

  • Genomic Role: The cobS gene is part of a cobalamin biosynthesis cluster in T. acidophilum, which lacks histones but relies on horizontally acquired genes for nutrient scavenging .

  • Enzymatic Function: CobS is implicated in salvaging cobinamide, a precursor to coenzyme B12, via a pathway distinct from bacterial systems . This aligns with T. acidophilum’s adaptation to nutrient-poor, acidic environments.

  • Structural Insights: While no crystal structure of cobS exists, homologous proteins in T. acidophilum (e.g., proteasomes, malic enzymes) exhibit thermostability and acid tolerance, suggesting cobS may share similar traits .

Research Applications

Recombinant cobS is utilized in:

  • Enzyme Mechanism Studies: Investigating cobalt incorporation and amidation in cobalamin synthesis under extreme conditions .

  • Industrial Biotechnology: Potential use in vitamin B12 production due to thermostability (optimal growth at 59°C and pH 2) .

  • Comparative Genomics: Studying evolutionary links between archaeal and bacterial cobalamin pathways .

Key Research Findings

  1. Expression and Purification:

    • Recombinant cobS is purified via Ni-NTA affinity chromatography, achieving >90% homogeneity .

    • Activity assays require reconstitution with cofactors (e.g., ATP, cobalt) due to its role in late-stage cobalamin assembly .

  2. Functional Interactions:

    • CobS operates alongside ABC transporters (e.g., CSP5_0849) for substrate uptake, critical in low-nutrient environments .

    • In Halobacterium spp., homologs of cobS enable cobinamide salvaging, highlighting conserved archaeal adaptations .

  3. Biotechnological Potential:

    • Enzymes from T. acidophilum (e.g., malic enzyme) are employed in CO2 fixation under mild conditions, suggesting cobS could enhance similar processes .

Unresolved Questions

  • Substrate Specificity: The exact biochemical role of cobS (e.g., methyltransferase vs. synthase) remains unconfirmed .

  • Structural Data: Lack of a resolved 3D structure limits mechanistic insights .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cobS; Ta1079; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Target Names
cobS
Target Protein Sequence
MKGLRSAFSFFTIIPIKSELDEHLIAYVPLVALFDAALAASLYVAIYGISKLLASFISVS AIYIVNGLNHVDAVADAGDAMMIRNRSRIREVFEDHDVGAGGVFTLIFVYLLALISLSSM DLYIGIFSIILAEFLSKSMMMITLHRSRPLFQGIGSLFIDLYRKHDSLYTVEFVVIPIVL ALLSRASIMISVALAFLIFIIVKMAVIRRFGGINGDLAGFIGELGRSIFLMISLIMAQSS VLSTYDILSKIMSSL
Uniprot No.

Target Background

Function
This enzyme catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin) from adenosylcobinamide-GDP and α-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.
Database Links

KEGG: tac:Ta1079

STRING: 273075.Ta1079

Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of Thermoplasma acidophilum cobalamin synthase (cobS)?

Thermoplasma acidophilum cobalamin synthase (cobS) catalyzes a critical step in the biosynthetic pathway of vitamin B12 (cobalamin), specifically the attachment of the upper axial ligand to the cobalt ion of the corrin ring. This enzyme is particularly important in archaea, which often utilize cobamides as essential cofactors for various enzymatic processes. In Thermoplasma acidophilum, cobamide-dependent ribonucleotide reductases have been purified and demonstrated to be active, indicating the functional importance of the cobalamin biosynthetic pathway in this organism .

The cobS enzyme belongs to the adenosyltransferase family and functions to convert cob(I)alamin to adenosylcobalamin, which serves as the active form (coenzyme B12) in many biological systems. This adenosylcobalamin contains a 5'-deoxyadenosyl group as the upper ligand, forming a covalent bond with the cobalt ion of the corrin ring . The lower ligand interacts with the cobalt via a coordination bond, together creating the complete cofactor structure essential for its biochemical activity.

How does T. acidophilum cobS differ from homologous enzymes in other organisms?

T. acidophilum cobS represents an archaeal variant of cobalamin synthase that has evolved to function under both thermophilic and acidophilic conditions. Unlike bacterial counterparts, the T. acidophilum enzyme demonstrates remarkable stability at elevated temperatures (optimal growth temperature of 55-60°C) and acidic pH. Comparative sequence analysis with other archaeal adenosyltransferases shows significant divergence, reflecting specialized adaptations to extreme environments.

When examining protein expression patterns in related acidophilic archaea, researchers have identified that Cob(I)alamin adenosyltransferase (with similarity to cobS) is overexpressed (1.47-fold increase) under cold shock conditions . This suggests temperature-dependent regulation of cobalamin metabolism in these extremophiles, potentially highlighting unique regulatory mechanisms not present in mesophilic organisms.

Further investigations into the primary sequence and tertiary structure would provide additional insights into the molecular adaptations enabling function under these extreme conditions, particularly the acid-stable active site architecture.

What archaeal model systems are suitable for studying T. acidophilum cobS function?

Several archaeal systems provide valuable comparative models for studying T. acidophilum cobS:

  • Methanogenic archaea: Methanobacterium thermoautotrophicum strain ΔH contains the cobY gene, which encodes a protein with nucleoside triphosphate:adenosylcobinamide-phosphate nucleotidyltransferase activity . While not identical to cobS function, this represents part of the same biosynthetic pathway and provides insights into archaeal cobalamin metabolism.

  • Halobacterium species: Halobacterium sp. strain NRC-1 possesses a functional cobY gene encoding a protein with 35% sequence identity and 48% similarity to the M. thermoautotrophicum ortholog . Null mutations in this gene result in cobinamide-GDP auxotrophy, demonstrating the essential role of these enzymes in archaeal cobamide biosynthesis.

  • Other Thermoplasmatales: Related acidophilic archaea such as Picrophilus species show 60% sequence identity in ABC transporters potentially involved in vitamin uptake , suggesting conserved pathways that may interact with cobalamin metabolism.

When studying T. acidophilum cobS function, these comparative systems can highlight conserved and divergent features of archaeal cobalamin biosynthesis, providing evolutionary context for the specialized adaptations in T. acidophilum.

What expression systems are optimal for producing recombinant T. acidophilum cobS?

The optimal expression system for recombinant T. acidophilum cobS requires careful consideration of the enzyme's extremophilic origin. Based on existing protocols for recombinant archaeal proteins, the following systems offer distinct advantages:

E. coli-based expression systems:

  • pET-based vectors with T7 promoter control provide high-level, inducible expression

  • BL21(DE3) derivatives with rare codon supplementation (e.g., Rosetta strains) help overcome codon bias issues

  • Cold-induction protocols (15-18°C) can significantly increase soluble protein yields by slowing folding kinetics

Archaeal host systems:

  • Homologous expression in related Thermoplasma species may preserve native folding environments

  • Heterologous expression in Sulfolobus species (which share optimal temperature ranges with T. acidophilum) can maintain thermostability during expression

Expression optimization table:

Expression SystemAdvantagesLimitationsRecommended Induction
E. coli BL21(DE3)High yield, easy handlingPotential misfolding0.1-0.5 mM IPTG, 18°C, 16h
E. coli ArcticExpressEnhanced folding at low temperaturesLower yield0.1 mM IPTG, 12°C, 24h
Sulfolobus systemNative-like folding environmentComplex media requirementsHeat induction, 55-60°C

The addition of molecular chaperones (GroEL/ES) has proven beneficial for many thermophilic enzymes when expressed in E. coli, potentially aiding proper folding of T. acidophilum cobS.

What purification strategies maximize activity retention for recombinant T. acidophilum cobS?

Purification of recombinant T. acidophilum cobS requires strategies that preserve the enzyme's native conformation and activity throughout the isolation process:

  • Initial capture and stabilization:

    • Use buffering systems that mimic T. acidophilum's acidic cytoplasmic environment (pH 4.5-5.5)

    • Include glycerol (10-20%) or trehalose (a compatible solute utilized by related archaea) to enhance stability

    • Add reducing agents (DTT or β-mercaptoethanol) to protect potential catalytic cysteine residues

  • Chromatographic purification sequence:

    • IMAC (Immobilized Metal Affinity Chromatography) with His-tagged constructs provides efficient initial capture

    • Ion exchange chromatography at pH 5.0-6.0 exploits the predicted acidic pI of the enzyme

    • Size exclusion chromatography in stabilizing buffer as a final polishing step

  • Activity preservation measures:

    • Maintain purification temperatures above 25°C to prevent cold-induced denaturation

    • Include potential cofactors such as divalent metals (Mg²⁺, Mn²⁺) throughout purification

    • Consider adding cobalamin precursors to stabilize the active site during purification

The CDC48 family ATPase from T. acidophilum forms complexes resembling 20S proteasome and Hsp60/GroEL , suggesting that T. acidophilum proteins may require specific chaperone-like conditions to maintain their native structures during purification.

How can inclusion body refolding be optimized for T. acidophilum cobS?

When recombinant T. acidophilum cobS forms inclusion bodies, a systematic refolding approach can recover enzymatic activity:

  • Inclusion body isolation and solubilization:

    • Wash inclusion bodies with mild detergents (0.1% Triton X-100) and low concentrations of urea (1-2 M)

    • Solubilize using 6-8 M urea or 4-6 M guanidine hydrochloride at elevated temperature (40-45°C)

    • Include reducing agents to maintain cysteine residues in reduced state

  • Refolding strategies:

    • Perform stepwise dialysis with decreasing denaturant concentration at 40-45°C

    • Include arginine (0.4-0.8 M) as aggregation suppressor

    • Add potential cofactors (ATP, metal ions) to facilitate correct folding

    • Monitor refolding by measuring activity recovery at each step

  • Post-refolding processing:

    • Remove misfolded aggregates by centrifugation or filtration

    • Concentrate refolded protein using size-specific membranes

    • Perform final purification by size exclusion chromatography

Refolding buffer optimization table:

ComponentConcentration RangeRationale
Tris or HEPES50-100 mM, pH 7.0-8.0Initial refolding at neutral pH before acidic buffer exchange
Arginine0.4-0.8 MSuppresses aggregation
Glycerol10-20%Stabilizes folding intermediates
GSH:GSSG10:1 (5 mM:0.5 mM)Facilitates disulfide bond formation/reshuffling
ATP/Mg²⁺5 mM/10 mMSupports proper active site formation

This approach leverages thermophilic protein stability to achieve gradual refolding while preventing aggregation.

What spectroscopic methods are suitable for monitoring T. acidophilum cobS activity?

Several spectroscopic approaches can effectively monitor the enzymatic activity of T. acidophilum cobS:

  • UV-Visible spectroscopy:

    • Track the conversion of cob(I)alamin to adenosylcobalamin via characteristic absorbance shifts

    • Monitor at wavelengths 388 nm and 525 nm (cob(I)alamin) versus 522 nm (adenosylcobalamin)

    • Perform kinetic measurements under anaerobic conditions to prevent oxidation of cob(I)alamin

  • Fluorescence-based assays:

    • Utilize the intrinsic fluorescence of adenine moieties to track adenosylation

    • Monitor FRET-based approaches with labeled substrates to assess binding kinetics

    • Employ fluorescent ATP analogs to track ATP consumption during the reaction

  • HPLC-based activity monitoring:

    • Implement HPLC-UV detection methods for CoA esters to measure enzymatic activity, similar to approaches used for CLYBL enzyme characterization

    • Develop high-resolution LC-MS methods for detecting reaction intermediates and products

    • Compare forward and reverse reactions to determine reaction directionality and equilibrium constants

These approaches should be optimized for the acidic pH and elevated temperature conditions where T. acidophilum enzymes typically function optimally, as suggested by the growth conditions (55-60°C) .

How does temperature and pH affect T. acidophilum cobS kinetics?

As an enzyme from a thermoacidophilic archaeon, T. acidophilum cobS likely exhibits distinctive temperature and pH-dependent kinetic parameters:

Temperature effects:

  • Optimal activity would be expected at 55-60°C, corresponding to the optimal growth temperature of T. acidophilum

  • Arrhenius plots likely show linear relationships up to 55-60°C, with potential deviations at higher temperatures due to protein unfolding

  • Cold-shock response data from related acidophiles suggests significantly reduced activity below 40°C, as cold conditions induce upregulation of Cob(I)alamin adenosyltransferase (1.47-fold increase)

pH-dependent kinetics:

  • Optimal activity would likely occur at pH 1-3 for extracellular activity or pH 4-6 for intracellular activity, reflecting T. acidophilum's acidophilic nature

  • Kinetic parameters (kcat, KM) should be determined across pH 1-7 to establish the complete pH profile

  • Critical ionizable residues can be identified through pH-rate profiles and compared with homology models

Integrated temperature-pH effects:

  • The interplay between temperature and pH optima likely reflects specific adaptations in the enzyme's active site

  • Kinetic parameters should be measured in a matrix of temperature and pH conditions to construct 3D activity landscapes

  • Stability measurements (half-life determinations) at various temperature-pH combinations will reveal the enzyme's operational boundaries

These characterizations provide fundamental insights into the molecular adaptations enabling T. acidophilum cobS to function in extreme conditions.

What are the essential cofactors and substrate specificities for T. acidophilum cobS?

T. acidophilum cobS likely requires specific cofactors and demonstrates distinct substrate preferences reflecting its specialized biochemical role:

Cofactor requirements:

  • ATP or other nucleoside triphosphates serve as adenosyl donors in the reaction

  • Divalent metal ions (likely Mg²⁺) are essential for nucleotide binding and catalysis

  • Reducing conditions maintain the cobalt in the corrin ring in the active Co(I) oxidation state

Substrate specificity analysis:

  • Primary substrate is likely cob(I)alamin, with the enzyme catalyzing the addition of the 5'-deoxyadenosyl group

  • Substrate analogs with modifications to the corrin ring structure can reveal binding site tolerances

  • Alternative adenosyl donors beyond ATP may be accepted with varying efficiencies

Kinetic parameters table:

Substrate/CofactorKM (μM)kcat (s⁻¹)kcat/KM (M⁻¹s⁻¹)
Cob(I)alaminTo be determined experimentallyTo be determined experimentallyTo be determined experimentally
ATPTo be determined experimentallyTo be determined experimentallyTo be determined experimentally
Mg²⁺To be determined experimentallyTo be determined experimentallyTo be determined experimentally

The enzyme's involvement in the biosynthesis pathway that produces active cobamides with upper and lower ligands suggests specific structural constraints on substrate recognition, as these ligands play important roles in the chemistry catalyzed by cobamides .

How can structural biology approaches provide insights into T. acidophilum cobS mechanisms?

Structural biology techniques offer powerful approaches to elucidate the molecular mechanisms of T. acidophilum cobS:

  • X-ray crystallography:

    • Crystallization screens should explore acidic conditions (pH 3-6) and elevated temperatures to mimic native environments

    • Co-crystallization with substrates, products, and substrate analogs can capture different catalytic states

    • Structure determination of apo and holo forms can reveal conformational changes upon substrate binding

  • Cryo-electron microscopy:

    • Single-particle analysis can determine structures without crystallization

    • Time-resolved approaches may capture transient catalytic intermediates

    • Structural comparisons with homologous enzymes from non-thermophilic sources can highlight adaptations to extreme conditions

  • NMR spectroscopy:

    • Solution NMR can examine protein dynamics under native-like conditions

    • Chemical shift perturbation experiments reveal substrate binding interfaces

    • Hydrogen-deuterium exchange studies identify regions with differential stability

  • Computational approaches:

    • Molecular dynamics simulations at elevated temperatures can model thermal stability mechanisms

    • Quantum mechanics/molecular mechanics (QM/MM) calculations can elucidate the electronic structure of the active site

    • Sequence-based structural predictions can guide mutagenesis studies in the absence of experimental structures

Structural data would be particularly valuable for understanding how T. acidophilum cobS maintains catalytic activity under acidic conditions that would typically denature mesophilic proteins, potentially providing insights similar to those gleaned from studies of CDC48 family ATPase from T. acidophilum .

How can protein engineering enhance the stability and activity of recombinant T. acidophilum cobS?

Protein engineering approaches can further optimize T. acidophilum cobS for research applications:

  • Rational design strategies:

    • Introduce additional salt bridges at the protein surface to enhance thermostability

    • Optimize surface charge distribution to maintain solubility at neutral pH while preserving acidic active site

    • Engineer allosteric regulation sites to control enzyme activity

    • Create fusion constructs with affinity tags positioned to minimize interference with the active site

  • Directed evolution approaches:

    • Develop high-throughput screening assays based on cobS activity

    • Implement error-prone PCR to generate variant libraries

    • Apply selection pressure mimicking extreme conditions to identify superior variants

    • Use iterative cycles of mutagenesis and selection to accumulate beneficial mutations

  • Chimeric enzyme development:

    • Create hybrid enzymes combining domains from T. acidophilum cobS with homologous enzymes from other extremophiles

    • Explore domain swapping to identify critical regions for thermostability

    • Integrate functional motifs from mesophilic counterparts to modify substrate specificity

  • Computational design:

    • Apply machine learning algorithms to predict stabilizing mutations

    • Use Rosetta-based approaches to design optimized active sites

    • Implement molecular dynamics simulations to predict stability of engineered variants

These approaches can yield variants with enhanced stability, broader pH tolerance, or modified substrate specificity for specialized research applications.

What insights can T. acidophilum cobS provide about the evolution of cobalamin biosynthesis?

T. acidophilum cobS offers a unique evolutionary perspective on cobalamin biosynthesis:

  • Archaeal-bacterial pathway divergence:

    • Comparative analysis with bacterial cobalamin synthases can highlight domain-specific adaptations

    • Identification of archaeal-specific sequence motifs may reveal alternative catalytic mechanisms

    • Examination of gene neighborhoods can elucidate pathway organization differences between domains

  • Adaptations to extreme environments:

    • Structural and biochemical comparisons with mesophilic homologs can identify thermostability determinants

    • Sequence analysis across extremophiles can reveal convergent adaptations to similar environmental pressures

    • Investigation of substrate specificity may indicate environment-specific pathway modifications

  • Horizontal gene transfer:

    • Phylogenetic analyses can identify potential horizontal gene transfer events in cobalamin biosynthesis

    • Comparison with related enzymes such as the cobY gene in Halobacterium sp. strain NRC-1 (which shares 35% identity with its Methanobacterium thermoautotrophicum homolog) can trace evolutionary relationships

    • Codon usage analysis can detect recent gene transfers between domains

  • Ancestral sequence reconstruction:

    • Infer ancestral sequences of cobalamin synthases to understand the evolutionary trajectory

    • Express and characterize reconstructed ancestral enzymes to examine functional shifts

    • Model evolutionary pressures on cobalamin biosynthesis across different environments

This evolutionary perspective could provide context similar to the observed sequence relationships between T. acidophilum proteins and those from diverse archaea such as Picrophilus, Sulfolobus, and uncultured Thermoplasmatales species .

Why might recombinant T. acidophilum cobS exhibit low activity in heterologous expression systems?

Several factors could contribute to low activity of recombinantly expressed T. acidophilum cobS:

  • Incompatible environmental conditions:

    • Neutral pH of standard assay buffers may be incompatible with the enzyme's acidophilic nature

    • Room temperature assays fall well below T. acidophilum's optimal growth temperature (55-60°C)

    • Standard reducing agents may insufficiently maintain the active redox state

  • Incomplete cofactor incorporation:

    • Limited availability of essential metal ions in expression host

    • Absence of specialized assembly factors present in the native host

    • Insufficient concentrations of cobalamin precursors during expression

  • Structural issues:

    • Improper folding in mesophilic expression hosts

    • Incorrect disulfide bond formation

    • Missing post-translational modifications

  • Experimental design complications:

    • Inappropriate assay conditions masking actual activity

    • Interfering components in the purification buffer

    • Oxidation of cobalamin substrates during handling

Systematic troubleshooting approach:

IssueDiagnostic TestSolution Strategy
pH incompatibilityActivity profile across pH 2-8Reformulate assay buffers at optimal pH
Temperature suboptimalityActivity profile from 25-70°CConduct assays at elevated temperatures
Cofactor deficiencyActivity rescue with exogenous cofactorsSupplement assay with potential cofactors
Structural misfoldingCircular dichroism analysisRefold protein under optimized conditions
Substrate oxidationAnaerobic activity testingConduct assays under strict anaerobic conditions

Comparative analysis with other archaeal enzymes that show improved activity under extreme conditions could provide insights into optimal handling conditions .

What are the best approaches for studying protein-protein interactions involving T. acidophilum cobS?

Investigating protein-protein interactions for T. acidophilum cobS requires specialized approaches:

  • Pull-down assays and co-immunoprecipitation:

    • Perform at elevated temperatures (40-55°C) to maintain native conformations

    • Use acidic buffers (pH 4-6) to preserve physiologically relevant interactions

    • Include stabilizing agents like trehalose (a compatible solute mentioned in related archaeal studies)

  • Surface plasmon resonance (SPR):

    • Immobilize cobS on sensor chips using oriented coupling strategies

    • Flow potential interaction partners under temperature and pH conditions mimicking T. acidophilum cytoplasm

    • Perform kinetic analysis to determine association and dissociation constants

  • Microscale thermophoresis (MST):

    • Label cobS with fluorescent dyes stable at elevated temperatures

    • Titrate potential binding partners under native-like conditions

    • Analyze thermophoretic movement changes to determine binding affinities

  • Cross-linking mass spectrometry:

    • Apply thermostable cross-linking reagents to T. acidophilum cell extracts

    • Identify cobS interaction partners through mass spectrometry

    • Map interaction interfaces using distance constraints from cross-links

  • Bacterial/yeast two-hybrid systems adapted to extremophiles:

    • Develop specialized two-hybrid systems using thermophilic hosts

    • Create acidophilic variants of existing two-hybrid systems

    • Utilize chimeric constructs with thermostable reporter domains

These approaches could identify potential interactions similar to those observed in other archaeal systems, such as the complex formations seen with the CDC48 family ATPase from T. acidophilum .

How can isotope labeling enhance mechanistic studies of T. acidophilum cobS?

Isotope labeling strategies provide powerful tools for mechanistic investigations of T. acidophilum cobS:

  • Kinetic isotope effect studies:

    • Synthesize substrates with isotopic substitutions at key positions

    • Measure reaction rates with labeled versus unlabeled substrates

    • Identify rate-limiting steps and transition state structures

  • NMR-based structure and dynamics:

    • Express ¹⁵N, ¹³C-labeled cobS for backbone assignment

    • Perform selective labeling of specific amino acid types to focus on catalytic residues

    • Conduct relaxation experiments to identify flexible regions potentially involved in catalysis

  • Mass spectrometry approaches:

    • Use heavy isotope-labeled substrates to track product formation

    • Implement time-resolved mass spectrometry to detect reaction intermediates

    • Perform hydrogen-deuterium exchange mass spectrometry to identify solvent-accessible regions

  • Neutron crystallography:

    • Replace exchangeable hydrogens with deuterium to visualize protonation states

    • Determine positions of hydrogen atoms in the active site

    • Elucidate proton transfer mechanisms in the acidic active site

Isotope labeling strategy table:

IsotopeApplicationExpected Insight
²H at substrate C-H positionsKinetic isotope effect studiesIdentify bond-breaking steps
¹⁵N protein labelingNMR dynamics studiesMap flexible regions and binding sites
¹⁸O in phosphate groupsMass spectrometry trackingDetermine ATP cleavage mechanism
¹³C at specific positionsSite-specific NMR spectroscopyMonitor chemical environment changes during catalysis

These approaches could provide mechanistic insights comparable to those obtained for other archaeal enzymes like the CLYBL enzyme, where detailed enzymatic activities were characterized through in vitro studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.