Recombinant Thermoplasma acidophilum Probable cobalamin biosynthesis protein CobD (cobD)

Shipped with Ice Packs
In Stock

Description

Overview and Functional Role

Recombinant Thermoplasma acidophilum CobD is a pyridoxal phosphate (PLP)-dependent enzyme implicated in the biosynthesis of cobalamin (vitamin B₁₂). CobD catalyzes the decarboxylation of L-threonine O-3-phosphate to produce (R)-1-amino-2-propanol O-2-phosphate, a critical precursor for the nucleotide loop assembly in adenosylcobinamide phosphate synthesis . This reaction is essential for corrinoid salvaging and de novo cobalamin biosynthesis in archaea, enabling cobalt insertion into the corrin ring structure .

Biochemical Pathway Involvement

CobD operates in the aerobic cobalamin biosynthesis pathway:

  1. Substrate Specificity: Decarboxylates L-threonine O-3-phosphate to yield (R)-1-amino-2-propanol O-2-phosphate .

  2. Downstream Role: The product is incorporated into adenosylcobyric acid via the kinase activity of CobU, forming adenosylcobinamide phosphate .

  3. Metabolic Context: Enables T. acidophilum to assimilate environmental cobinamide, bypassing de novo corrin ring synthesis .

Genetic and Regulatory Features

  • Gene Localization: Part of the cob operon in archaeal genomes, co-regulated with corrinoid salvage pathways .

  • Functional Complementation: cobD mutants require exogenous (R)-1-amino-2-propanol for cobalamin biosynthesis, confirming its role in precursor synthesis .

Comparative Analysis with Bacterial Homologs

FeatureT. acidophilum CobDS. typhimurium CobD
Decarboxylase ActivityL-threonine O-3-phosphate → aminopropanol-PSame substrate and product
Oxygen DependencyAerobic pathwayAnaerobic pathway
Structural MotifsPLP-binding domain; dimeric interfaceSimilar dimeric structure

Research Implications

  • Biotechnological Applications: Recombinant CobD could optimize microbial cobalamin production, leveraging its salvage pathway efficiency .

  • Evolutionary Significance: Structural similarities to aminotransferases suggest divergent evolution from PLP-dependent decarboxylases .

Unresolved Questions

  • Enzyme Kinetics: Detailed kinetic parameters for T. acidophilum CobD remain uncharacterized.

  • Regulatory Mechanisms: Interaction partners and transcriptional regulation in archaea are poorly understood .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cobD; Ta0076; Probable cobalamin biosynthesis protein CobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Target Names
cobD
Target Protein Sequence
MIIILIGAIAIDIIFGEPKEYIHPVVFSGKVSKRIETYFRHHDNRIVYGSIFAVAVIVIT AIPYFLAIYVSSFVLVIYVIVSMVILKTTFSISAMGDHIRLVVESLKNGNISDARVYLSR VVRRDTSNLNENEISSAAIETIAEGLVDGYMTPLFFFIFLGIPGAFVARIINTLDSMCGY KDRENFEFGRFSAFMDTVINYIPARLSWFFIGFSADVLNYRHKVISPRKYVSRFDSVNAG WPISTMACALNLRLEKRGSYIVNDEGYQPSVRDIERSMHVFYVAVYSYTIIFVLPLLVAM AFLL
Uniprot No.

Target Background

Function

This protein catalyzes the conversion of cobyric acid to cobinamide through the addition of aminopropanol to the F carboxylic group.

Database Links

KEGG: tac:Ta0076

STRING: 273075.Ta0076

Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural classification of CobD and its role in cobalamin biosynthesis?

CobD functions as an L-threonine O-3-phosphate decarboxylase that generates (R)-1-amino-2-propanol O-2-phosphate, a critical component in the nucleotide loop assembly of adenosylcobalamin (AdoCbl) . Structurally, CobD belongs to the family of aspartate aminotransferases, with particularly close structural homology to histidinol phosphate aminotransferase, suggesting an evolutionary relationship between these enzymes . In Salmonella Typhimurium, CobD has been resolved as a dimeric protein comprising large and small domains in each subunit, and this structural arrangement is likely conserved in T. acidophilum . The protein plays a crucial role in the synthesis of the aminopropanol component of the nucleotide loop in cobalamin.

How does T. acidophilum CobD compare functionally to CobD in other organisms?

While specific data on T. acidophilum CobD is limited in the available literature, comparative studies with other organisms like Salmonella Typhimurium provide valuable insights. In S. Typhimurium, CobD catalyzes the decarboxylation of L-threonine O-3-phosphate to produce (R)-1-amino-2-propanol O-2-phosphate, which is subsequently incorporated into cobyric acid during nucleotide loop assembly . Research has demonstrated that cobalamin biosynthesis in S. Typhimurium cobD mutants can be restored by the addition of exogenous (R)-aminopropanol, suggesting a phosphorylation step before incorporation into cobyric acid . This functional conservation suggests T. acidophilum CobD likely performs similar reactions in the cobalamin biosynthetic pathway, though potentially with adaptations suited to the extremophilic nature of T. acidophilum.

What experimental approaches should be used to confirm CobD expression in T. acidophilum?

To confirm CobD expression in T. acidophilum, researchers should employ a multi-faceted approach. Begin with PCR amplification and sequencing of the putative cobD gene from T. acidophilum genomic DNA to confirm its presence and sequence integrity. Follow this with RT-PCR and qRT-PCR to measure transcript levels under various growth conditions, particularly examining expression patterns in response to cobalamin availability. Protein expression can be confirmed through western blotting using antibodies specifically raised against recombinant T. acidophilum CobD. Mass spectrometry-based proteomics offers a complementary approach to detect and quantify CobD in cellular extracts. Finally, immunolocalization studies can determine the subcellular localization of CobD, which could provide insights into its functional interactions within the cobalamin biosynthetic pathway in this archaeal organism.

What are the optimal conditions for expressing and purifying recombinant T. acidophilum CobD?

Based on similar research with archaeal proteins, recombinant T. acidophilum CobD expression should be optimized using the following methodological approach:

  • Vector Selection: Choose expression vectors with strong, inducible promoters like T7 or tac. Consider adding a purification tag (His6, GST, or MBP) to facilitate downstream purification.

  • Host Selection: E. coli BL21(DE3) or Rosetta strains are recommended for expression of archaeal proteins, with the latter providing rare codons that may be present in the T. acidophilum sequence .

  • Temperature Optimization: Since T. acidophilum is thermophilic, expression at elevated temperatures (30-37°C) may improve protein folding, though initial screening should test multiple temperatures.

  • Expression Conditions:

    • Induce at OD600 of 0.6-0.8

    • Test IPTG concentrations from 0.1-1.0 mM

    • Consider lower temperature induction (16-25°C) for longer periods (overnight) to improve solubility

  • Purification Strategy:

    • Initial capture via affinity chromatography (Ni-NTA for His-tagged proteins)

    • Secondary purification by ion exchange chromatography

    • Final polishing by size exclusion chromatography to ensure homogeneity

This multi-step approach is critical for obtaining pure, active enzyme for subsequent structural and functional studies. Researchers should validate the purified protein via SDS-PAGE, western blotting, and mass spectrometry to confirm identity and purity.

How can structural studies inform understanding of T. acidophilum CobD catalytic mechanism?

Structural studies of T. acidophilum CobD can provide critical insights into its catalytic mechanism through several methodological approaches:

X-ray crystallography remains the gold standard for determining atomic-level structures. Crystallizing T. acidophilum CobD in multiple states—apo enzyme, substrate-bound, and product-bound forms—would reveal conformational changes during catalysis . Based on studies of S. Typhimurium CobD, researchers should focus on resolving the structures of T. acidophilum CobD in complex with L-threonine O-3-phosphate (substrate) and (R)-1-amino-2-propanol O-2-phosphate (product) to elucidate the reaction pathway.

Molecular dynamics simulations can complement crystallographic data by modeling protein flexibility and substrate interactions. These computational approaches are particularly valuable for understanding how T. acidophilum CobD might direct the breakdown of the external aldimine complex toward decarboxylation rather than amino transfer, a mechanistic feature observed in S. Typhimurium CobD .

Site-directed mutagenesis of conserved active site residues, followed by kinetic analysis of the mutant enzymes, can experimentally validate the structural predictions. Researchers should target residues that correspond to those in the S. Typhimurium CobD active site, which has been shown to be structurally similar to histidinol phosphate aminotransferase .

What experimental approaches can best characterize enzymatic activity of T. acidophilum CobD?

To characterize the enzymatic activity of T. acidophilum CobD, researchers should implement a comprehensive biochemical analysis strategy:

  • Spectrophotometric Assays: Develop coupled enzyme assays that link CobD activity to detectable spectrophotometric changes. For example, the production of (R)-1-amino-2-propanol O-2-phosphate could be coupled to NADH oxidation through appropriate enzyme partners.

  • HPLC Analysis: Establish HPLC methods to directly quantify substrate consumption and product formation. Use standard curves of L-threonine O-3-phosphate and (R)-1-amino-2-propanol O-2-phosphate for accurate quantification.

  • Mass Spectrometry: Employ LC-MS/MS to monitor reaction progress with high sensitivity and specificity, particularly useful for detecting intermediate compounds in the reaction.

  • Isothermal Titration Calorimetry (ITC): Measure the thermodynamic parameters of substrate binding, providing insights into binding affinity and stoichiometry.

  • Enzyme Kinetics Analysis: Determine key kinetic parameters (Km, kcat, kcat/Km) under various conditions to understand:

    • pH dependence (expected optimum may be acidic, reflecting T. acidophilum's native environment)

    • Temperature dependence (likely with high temperature optima given the thermophilic nature of the source organism)

    • Metal ion requirements and inhibition patterns

  • Substrate Specificity Testing: Evaluate activity with structural analogs of L-threonine O-3-phosphate to define the substrate scope.

These methodological approaches will provide a comprehensive understanding of T. acidophilum CobD catalytic properties and its role in the cobalamin biosynthetic pathway.

How does T. acidophilum cobalamin biosynthesis compare to the pathways in E. coli and S. typhimurium?

The cobalamin biosynthesis pathways exhibit important differences across bacterial and archaeal species. While E. coli can synthesize adenosylcobalamin (AdoCbl) from cobinamide (Cbi) but cannot synthesize the corrin ring de novo, S. typhimurium can perform both processes, though corrin ring synthesis occurs only under anoxic conditions . T. acidophilum, as an archaeal thermoacidophile, likely possesses unique adaptations to its pathway.

In E. coli and S. typhimurium, CobD functions as an L-threonine O-3-phosphate decarboxylase, generating (R)-1-amino-2-propanol O-2-phosphate for the nucleotide loop assembly . The presence of cobD alongside other cobalamin biosynthesis genes in T. acidophilum suggests functional conservation despite phylogenetic distance.

A key distinction may lie in the regulation and organization of the biosynthetic genes. In S. typhimurium, cobalamin biosynthesis is correlated with 1,2-propanediol (1,2-Pdl) degradation, with coregulation of Cbl biosynthesis and 1,2-Pdl utilization (pdu) genes . Whether similar regulatory mechanisms exist in T. acidophilum remains to be determined.

Table 1: Comparative Analysis of Cobalamin Biosynthesis Capabilities

OrganismDe novo corrin ring synthesisCobinamide to AdoCbl conversionCobD functionGrowth conditions for synthesis
E. coliNoYesL-threonine O-3-phosphate decarboxylaseAerobic or anaerobic
S. typhimuriumYes (anoxic only)YesL-threonine O-3-phosphate decarboxylaseAnoxic for complete pathway
T. acidophilumPredicted yesPredicted yesPredicted L-threonine O-3-phosphate decarboxylaseUnknown (likely aerobic)

What evolutionary insights can be gained from studying T. acidophilum CobD structure and function?

T. acidophilum CobD structural and functional studies offer valuable evolutionary insights into cobalamin biosynthesis. As an archaeal protein, T. acidophilum CobD represents an important point of comparison for understanding the evolution of cobalamin biosynthesis across domains of life.

The structural similarity between CobD and histidinol phosphate aminotransferase, as observed in S. typhimurium , suggests an evolutionary relationship between these enzymes. Comparative structural analysis of T. acidophilum CobD could reveal whether this relationship is conserved across domains and provide insights into the evolution of enzyme specificity and catalytic mechanism.

The presence of CobD in an archaeal thermoacidophile like T. acidophilum indicates the ancient origins of cobalamin biosynthesis pathways. Structural adaptations in T. acidophilum CobD that enable function at high temperatures and low pH would reveal evolutionary strategies for enzyme adaptation to extreme environments.

Phylogenetic analysis comparing T. acidophilum CobD with homologs from bacteria and other archaea can help reconstruct the evolutionary history of this enzyme, potentially identifying horizontal gene transfer events and adaptation-driven sequence changes. This evolutionary context is essential for understanding the broader significance of cobalamin biosynthesis across life forms and may inform synthetic biology applications for cobalamin production in non-native hosts.

What are the optimal approaches for analyzing CobD expression patterns in T. acidophilum?

Analyzing CobD expression patterns in T. acidophilum requires a comprehensive experimental approach that accounts for the organism's unique physiology as a thermoacidophile. Researchers should implement the following methodological strategy:

  • Growth Condition Optimization: Culture T. acidophilum under various conditions to assess CobD expression:

    • Temperature gradients (45-65°C)

    • pH ranges (1-5)

    • Nutrient availability variations

    • Presence/absence of cobalamin precursors

    • Aerobic versus microaerobic conditions

  • Transcriptional Analysis:

    • RNA-Seq to measure global transcriptional changes and identify cobD co-regulated genes

    • qRT-PCR with cobD-specific primers for quantitative expression analysis

    • 5' RACE to identify transcription start sites and potential regulatory elements

  • Translational Analysis:

    • Western blotting with anti-CobD antibodies

    • Targeted proteomics (MRM/PRM) for absolute quantification

    • Global proteomics to identify co-expressed proteins in the cobalamin biosynthesis pathway

  • Data Analysis Strategy:

    • Apply experimental design principles from big data analysis for optimal sampling

    • Implement Algorithm 1 from source for experimental design optimization

    • Use grid search over the design region with appropriate parameters

  • Statistical Analysis:

    • Perform multifactorial ANOVA to assess the significance of different growth conditions

    • Apply principle component analysis to identify patterns in gene expression data

    • Calculate correlation coefficients between cobD expression and other genes in the pathway

This systematic approach will provide insights into the regulation of CobD expression and its role within the broader context of cobalamin biosynthesis in T. acidophilum.

How should researchers design mutagenesis studies to investigate T. acidophilum CobD catalytic mechanism?

When designing mutagenesis studies to investigate the catalytic mechanism of T. acidophilum CobD, researchers should implement a rational, structure-guided approach:

  • Target Residue Selection Strategy:

    • Identify conserved active site residues through multiple sequence alignment with CobD from S. typhimurium and other organisms

    • Focus on residues implicated in substrate binding, particularly those interacting with the threonine moiety

    • Target residues that may direct the reaction toward decarboxylation rather than transamination

    • Include residues at the dimer interface to assess the functional significance of dimerization

  • Mutagenesis Approach:

    • Use site-directed mutagenesis to create a library of single amino acid substitutions

    • Create conservative substitutions (e.g., Asp → Glu) to probe the importance of specific chemical properties

    • Generate non-conservative substitutions (e.g., Asp → Ala) to completely ablate side chain functionality

    • Consider double mutants to investigate potential synergistic effects

  • Functional Characterization:

    • Implement a standardized kinetic assay protocol for all mutants

    • Measure kinetic parameters (Km, kcat, kcat/Km) across varying substrate concentrations

    • Determine pH and temperature profiles for each mutant

    • Assess thermostability changes using thermal shift assays

  • Structural Analysis:

    • Obtain crystal structures of key mutants in apo, substrate-bound, and product-bound states

    • Use molecular dynamics simulations to model the effects of mutations on protein dynamics

  • Data Integration:

    • Create a structure-function relationship matrix correlating mutational effects with structural positions

    • Develop a comprehensive catalytic mechanism model integrating all experimental data

This systematic approach will provide detailed insights into the catalytic mechanism of T. acidophilum CobD and how it may differ from homologs in other organisms due to adaptations to extreme conditions.

How can researchers overcome challenges in purifying active recombinant T. acidophilum CobD?

Purifying active recombinant T. acidophilum CobD presents several challenges that can be addressed through advanced methodological approaches:

  • Protein Solubility Issues:

    • Implement a fusion tag strategy using MBP (maltose-binding protein) or SUMO tags known to enhance solubility

    • Optimize expression conditions, particularly testing reduced temperatures (16-25°C) during induction

    • Incorporate stabilizing additives in lysis buffers (glycerol 10-20%, specific ions, osmolytes)

    • Consider cell-free expression systems for difficult-to-express proteins

  • Protein Stability Concerns:

    • Design buffers that mimic T. acidophilum's natural acidic environment (pH 2-5)

    • Include thermal stabilizers appropriate for thermophilic proteins (trehalose, specific salt concentrations)

    • Perform thermal shift assays to identify optimal buffer components

    • Consider incorporating natural ligands or substrate analogs during purification

  • Activity Retention:

    • Minimize exposure to oxidizing conditions by including reducing agents

    • Screen for potential cofactors that might be required for proper folding

    • Test different metal ions that might be essential for structural integrity or catalytic activity

    • Develop rapid purification protocols to minimize time between cell lysis and final storage

  • Catalytic Validation:

    • Establish a sensitive activity assay for quality control during purification steps

    • Compare specific activities after each purification step to track activity loss

    • Optimize storage conditions (temperature, buffer composition, protein concentration)

  • Troubleshooting Strategy:

    • If initial attempts fail, consider coexpression with molecular chaperones (GroEL/ES, DnaK/J)

    • Implement refolding protocols from inclusion bodies if necessary

    • Consider native purification from T. acidophilum as a comparison standard

This systematic approach addresses the unique challenges presented by thermoacidophilic proteins and should be adjusted based on preliminary results during the purification process development.

What analytical techniques are most appropriate for detecting intermediates in the T. acidophilum CobD-catalyzed reaction?

To effectively detect and characterize intermediates in the T. acidophilum CobD-catalyzed reaction, researchers should employ a complementary suite of analytical techniques:

  • Rapid Kinetics Methods:

    • Stopped-flow spectroscopy to capture transient intermediates on millisecond timescales

    • Quench-flow techniques coupled with analytical methods to trap reaction intermediates at defined time points

    • Temperature-jump experiments particularly useful for thermophilic enzymes to initiate reactions rapidly

  • Advanced Spectroscopic Techniques:

    • UV-visible spectroscopy to monitor changes in chromophoric groups during catalysis

    • Circular dichroism spectroscopy to detect conformational changes associated with intermediate formation

    • Fluorescence spectroscopy exploiting intrinsic tryptophan fluorescence or introduced fluorescent probes

    • FTIR spectroscopy to identify changes in specific chemical bonds during the reaction

  • Mass Spectrometry Approaches:

    • High-resolution LC-MS/MS for identification of reaction intermediates with exact mass determination

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe conformational dynamics

    • Ion mobility-mass spectrometry (IM-MS) for separating isomeric intermediates

    • Time-resolved electrospray ionization mass spectrometry for capturing short-lived species

  • NMR Spectroscopy:

    • Real-time 31P NMR to monitor phosphorylated intermediates

    • 13C and 15N labeled substrates for tracking atom transfer during catalysis

    • 2D NMR techniques for complete structural characterization of stable intermediates

  • Computational Integration:

    • Quantum mechanics/molecular mechanics (QM/MM) calculations to model transition states

    • Density functional theory (DFT) to predict spectroscopic properties of proposed intermediates

    • Integration of experimental data with computed reaction trajectories for mechanism validation

This multi-faceted analytical approach will enable researchers to develop a comprehensive understanding of the reaction mechanism, including the formation and decay of key reaction intermediates in the CobD-catalyzed decarboxylation reaction.

What are the most promising future research directions for T. acidophilum CobD studies?

Based on current understanding and technological capabilities, several promising research directions emerge for T. acidophilum CobD:

  • Structural Biology Integration: Combining cryo-EM, X-ray crystallography, and computational modeling to develop a complete understanding of the enzyme's structure-function relationship, particularly focusing on adaptations that enable function in extreme conditions characteristic of T. acidophilum's environment.

  • Synthetic Biology Applications: Exploring the potential of T. acidophilum CobD as a biocatalyst for industrial processes that require thermostable and acid-tolerant enzymes, potentially enabling new green chemistry approaches for the synthesis of chiral aminoalcohols.

  • Systems Biology Context: Investigating the regulatory network controlling cobD expression in T. acidophilum and identifying interaction partners to understand how cobalamin biosynthesis is integrated with other metabolic pathways in this archaeon.

  • Comparative Evolutionary Studies: Conducting comprehensive phylogenetic analyses across archaea, bacteria, and eukaryotes to trace the evolutionary history of CobD and related enzymes, potentially revealing horizontal gene transfer events and convergent evolutionary adaptations.

  • Enzyme Engineering: Applying directed evolution and rational design approaches to modify T. acidophilum CobD for enhanced catalytic efficiency, altered substrate specificity, or improved stability under various conditions.

These research directions not only advance our fundamental understanding of cobalamin biosynthesis but also have potential applications in biotechnology, synthetic biology, and understanding the evolution of essential metabolic pathways across domains of life.

How can knowledge of T. acidophilum CobD inform broader studies of extremophile enzyme function?

The study of T. acidophilum CobD provides a valuable model system for understanding extremophile enzyme adaptation and function with implications extending beyond cobalamin biosynthesis:

Thermoacidophilic adaptations in CobD offer insights into molecular mechanisms that enable protein stability and function under dual extreme conditions (high temperature and low pH). Comparative analysis of salt bridge networks, hydrophobic core packing, and surface charge distribution between T. acidophilum CobD and mesophilic homologs can reveal general principles of protein adaptation to extreme environments.

The catalytic mechanism of T. acidophilum CobD, particularly how it maintains efficient decarboxylation under extreme conditions, can inform enzyme engineering efforts for industrial biocatalysis applications requiring thermostable and acid-resistant enzymes. These insights could enable the development of robust biocatalysts for pharmaceutical and chemical manufacturing processes.

Structural features that enable T. acidophilum CobD to maintain proper substrate binding and catalytic efficiency at elevated temperatures provide a framework for understanding how enzymes preserve reaction specificity despite increased molecular motion at high temperatures. This knowledge contributes to our fundamental understanding of enzyme catalysis and can guide the design of thermostable enzymes for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.