Recombinant Thermoplasma acidophilum UPF0290 protein Ta0107 (Ta0107)

What is Thermoplasma acidophilum UPF0290 protein Ta0107?

Ta0107 is a protein classified in the UPF0290 family, originating from the thermoacidophilic archaeon Thermoplasma acidophilum. This protein consists of 176 amino acid residues and is encoded by the Ta0107 gene locus in the T. acidophilum genome. The UniProt accession number for this protein is Q9HLW7. While its exact biological function remains under investigation, it belongs to a class of proteins found primarily in archaeal organisms that thrive in extreme conditions .

The amino acid sequence (MQSIILFIPALIANSGAVITGGHFIIDRGKKFIDGRRILGNGKTLSGYAGGIAIGTVTGFIIYLISTLFNYALGTYGTLAEAIIIPFIMATGSLTGDIAGSFVKRRIGIDRGGKGGLLDQWPFALMAFLFLYIFERPFFMYHYFYVTMIVILVIVPPIHRAVNIIGYKMHKKDVPW) suggests potential membrane association based on its hydrophobicity profile . Understanding this protein may provide insights into adaptations that allow Thermoplasma acidophilum to survive in acidic, high-temperature environments.

How should Ta0107 be properly stored and handled in laboratory settings?

Proper storage of recombinant Ta0107 is critical for maintaining protein integrity and activity. The protein should be stored in a Tris-based buffer containing 50% glycerol at -20°C for routine use, or at -80°C for extended storage periods . When working with the protein, it's important to establish a protocol that minimizes freeze-thaw cycles, as repeated freezing and thawing can lead to protein denaturation and loss of activity.

For daily experiments, prepare small working aliquots (typically 5-10 μL) that can be stored at 4°C for up to one week . When thawing frozen stocks, use a gradual thawing process on ice rather than rapid warming to room temperature. This methodological approach helps preserve protein structure, particularly important for thermostable proteins that may have unique folding properties.

What expression systems are recommended for producing recombinant Ta0107?

While specific expression data for Ta0107 is limited, insights can be drawn from successful approaches with other Thermoplasma acidophilum proteins. Escherichia coli expression systems, particularly those designed for thermostable proteins, represent a practical starting point. When designing an expression protocol, consider the following methodological approaches:

For optimal expression, design your protocol to include induction at a moderately elevated temperature (28-30°C) as this may enhance proper folding while maintaining good expression levels. Additionally, consider adding specific chaperones that assist in the folding of archaeal proteins in mesophilic expression systems.

What purification strategies are most effective for recombinant Ta0107?

Designing an effective purification strategy for Ta0107 requires consideration of its biochemical properties. Based on approaches used with other archaeal proteins, a multi-step chromatography protocol is recommended. The methodological approach should include:

• Initial capture using affinity chromatography (if a tag was incorporated) or ion exchange chromatography based on the protein's theoretical isoelectric point.

• Intermediate purification using hydrophobic interaction chromatography, which can be particularly effective for proteins with hydrophobic regions.

• Polishing step using size exclusion chromatography to remove aggregates and ensure homogeneity.

The purification of other T. acidophilum proteins has been successfully achieved using sequential chromatography steps including DEAE-Sepharose, Q-Sepharose, Phenyl-Sepharose, and Affi-Gel Blue columns . This approach can be adapted for Ta0107, with buffer conditions optimized to maintain protein stability throughout the purification process.

How can researchers experimentally determine the oligomeric state of Ta0107?

Determining the oligomeric state of Ta0107 requires a combination of complementary techniques. Other T. acidophilum proteins, such as Ta1207, have been shown to form homopentamers of 188 kDa , while proteins like glyceraldehyde dehydrogenase form tetramers . To characterize Ta0107's native state, implement the following methodological approach:

• Size exclusion chromatography with molecular weight standards to estimate the apparent molecular mass of the native protein.

• Native PAGE analysis compared against standards of known molecular weights.

• Dynamic light scattering to measure the hydrodynamic radius, which can be correlated to molecular mass.

• Analytical ultracentrifugation, particularly sedimentation velocity experiments, to determine the sedimentation coefficient and calculate molecular mass.

Cross-linking experiments using agents like glutaraldehyde may also provide evidence of oligomerization by covalently linking subunits, which can then be analyzed by SDS-PAGE. For precise determination, a combination of these techniques should be employed and results compared for consistency.

What crystallization strategies have proven successful for similar archaeal proteins?

Crystallization of archaeal proteins often benefits from their inherent stability. Based on successful crystallization of other T. acidophilum proteins like Ta1207 and proteins from thermophiles like TTHA0281 from Thermus thermophilus , the following methodological approach is recommended:

For Ta1207, crystals were obtained that allowed structure determination at 2.4 Å resolution using Se-MAD (selenium multi-wavelength anomalous dispersion) . This suggests incorporating selenomethionine into Ta0107 could facilitate phase determination if molecular replacement is not feasible due to lack of suitable structural homologs.

What experimental approaches can be used to determine the function of Ta0107?

Determining the function of hypothetical proteins like Ta0107 requires a multi-faceted approach. Similar methodologies have been applied to hypothetical proteins like TTHA0281 from Thermus thermophilus, which was speculated to be involved in RNA metabolism based on structural homology . For Ta0107, consider implementing the following experimental design:

• Structural characterization through X-ray crystallography or cryo-EM to identify potential binding pockets or catalytic sites.

• Comparative structural analysis against proteins of known function.

• Binding assays with potential substrates identified through bioinformatic prediction.

• Gene knockout or knockdown studies in Thermoplasma acidophilum to observe phenotypic changes.

• Pull-down assays coupled with mass spectrometry to identify interaction partners.

The deep pocket with a binding site for negatively charged groups observed in Ta1207 suggests that similar structural features in Ta0107 could provide clues about substrate specificity. Implementing these approaches systematically will help narrow down potential functions from an uncharacterized protein to specific biochemical roles.

How can researchers investigate the potential membrane association of Ta0107?

The amino acid sequence of Ta0107 contains several hydrophobic regions that suggest potential membrane association . To investigate this characteristic, implement the following methodological approaches:

• Membrane fractionation experiments to determine whether the native protein localizes to membrane fractions.

• Fluorescence microscopy using GFP-tagged Ta0107 to visualize cellular localization.

• Liposome binding assays to test direct interaction with lipid bilayers.

• Tryptophan fluorescence spectroscopy to monitor changes in the protein's environment upon membrane interaction.

Additionally, computational prediction tools can provide initial insights into potential transmembrane domains or membrane-associated regions. Combining these experimental and computational approaches will provide a comprehensive understanding of Ta0107's relationship with cellular membranes, which may be critical to its biological function.

What bioinformatic approaches can identify potential functional domains in Ta0107?

While experimental validation is essential, bioinformatic analysis can provide valuable preliminary insights into Ta0107's function. The methodological approach should include:

• Hidden Markov Model searches against known domain databases.

• Structural prediction using tools like AlphaFold2 to identify potential functional folds.

• Comparative analysis with characterized UPF0290 family members.

• Genomic context analysis to identify conserved gene neighborhoods that may suggest functional relationships.

This approach has proven valuable with other hypothetical proteins like TTHA0281, where structural homology suggested involvement in RNA metabolism . For Ta0107, careful analysis of predicted structural features may reveal similarity to proteins with known functions, providing testable hypotheses about its biological role.

How should researchers interpret thermal stability data for Ta0107?

As a protein from a thermoacidophilic organism, Ta0107 likely possesses considerable thermal stability. When analyzing thermal denaturation data, consider the following methodological approaches:

• Use differential scanning calorimetry (DSC) to determine the melting temperature (Tm) and thermodynamic parameters of unfolding.

• Compare Tm values obtained under different pH conditions to understand the relationship between thermal stability and acid tolerance.

• Analyze thermal denaturation curves for potential multi-state unfolding behavior, which may indicate structural domains with different stabilities.

When interpreting thermal stability data, it's important to consider that archaeal proteins often exhibit unusual denaturation profiles. The thermal stability of Ta0107 should be compared to both mesophilic homologs and other proteins from Thermoplasma acidophilum to contextualize the results within the broader spectrum of protein stability.

What approaches can resolve contradictory results in Ta0107 characterization studies?

When facing contradictory results in Ta0107 characterization, implement a systematic troubleshooting approach:

• Evaluate experimental conditions for differences that might explain discrepancies, particularly buffer composition, protein concentration, and temperature.

• Assess protein quality using multiple methods (SDS-PAGE, mass spectrometry, dynamic light scattering) to ensure results are not affected by protein heterogeneity.

• Implement orthogonal techniques to confirm disputed findings.

• Consider the possibility that Ta0107 may exist in multiple conformational states with different properties.

How can researchers effectively analyze the evolutionary relationships of Ta0107?

Understanding the evolutionary context of Ta0107 requires sophisticated phylogenetic analysis. The methodological approach should include:

• Collection of homologous sequences through iterative database searches.

• Multiple sequence alignment using algorithms optimized for distantly related sequences.

• Model selection for phylogenetic reconstruction based on statistical criteria.

• Tree construction using both maximum likelihood and Bayesian approaches.

• Evaluation of tree reliability through bootstrap analysis or posterior probabilities.

When interpreting evolutionary relationships, consider that homologs of archaeal proteins like Ta1207 occur only in Thermoplasmatales, suggesting their functions might be related to the extreme lifestyle of these archaea . Similarly, Ta0107's distribution pattern may provide insights into its functional importance in specialized ecological niches.

How can Ta0107 be applied as a potential tool in biotechnology?

The thermostable nature of Ta0107 suggests potential applications in biotechnology. By drawing parallels with other archaeal proteins like Ta1207, which was proposed as a fivefold-symmetric scaffold for nanotechnological applications , researchers can explore Ta0107's utility in similar contexts. The methodological approach for such applications should include:

• Detailed characterization of Ta0107's stability under various conditions relevant to biotechnological processes.

• Engineering studies to enhance desirable properties while maintaining stability.

• Proof-of-concept experiments demonstrating practical applications.

When developing Ta0107 as a biotechnological tool, it's important to systematically evaluate its performance against existing alternatives and clearly define the advantages conferred by its unique properties derived from its extremophilic origin.

What controls are essential when studying Ta0107 interactions with other biomolecules?

When investigating Ta0107's interactions with other biomolecules, rigorous controls are essential for reliable data interpretation. The methodological approach should include:

• Negative controls using unrelated proteins of similar size and charge properties.

• Competition assays with unlabeled potential binding partners to confirm specificity.

• Validation of interactions using multiple independent techniques (e.g., pull-down assays, surface plasmon resonance, microscale thermophoresis).

• Careful buffer selection to minimize non-specific interactions while maintaining protein stability.

Interpreting interaction data requires consideration of the experimental design principles outlined in source , particularly regarding the manipulation of variables while controlling the test environment. This approach ensures that observed interactions are specific to Ta0107 rather than artifacts of the experimental system.