Recombinant Thermoplasma acidophilum V-type ATP synthase subunit I (atpI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please include any such requests in your order notes and we will fulfill your needs.
Lead Time
Delivery time may vary based on your purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; Ta0008; V-type ATP synthase subunit I; V-ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-637
Protein Length
full length protein
Species
Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Target Names
atpI
Target Protein Sequence
MEKIRIIAPYSYRDPVISALHDLGVMQIEEMREDVDRLLSPAKASEQAKTVMDYLQKFRG YENILPKRPVRTRAKFTSLADILNEASKINIDDDIRIAVNRENDIAAAMKDIDSRLSALE YMKGYDFDVSIFNGKHFESYIIPDKNVDIKAFSSLNAEIVPLKNAFIITVAEDRTQDLSR IANSIGARLIHIPDLKGKPDDVIAMLNDERAKLDQAMQEIRKHLGDLSDKYYEKIAQIRE ALEIEAKKIDVEDKLKGTEYTFAVEGWIPSDSFGRVSDAINRVTGNSCIISTVKTNEMPP TLLRNPRRISLFEFFIKFYSLPEGTEYDPTLIFALVFPVFFGLMVGDWGYGLAILLISLF IIHRVDHPPAKSHIPRVISRFVLMIMSPQSLKTLAKALIPSSIVAIIAGLLFNEFFGFAI LPFTVFHVYAVLPKLMLIAGYIGLGMVVFGFILGFIEDLWMKDVKGAMDRLGWLFFAVGI ATIGLNLIHHDLTFSVSTGISNLIAVALIVIGIPLIAIKEKSQGFIEMPSIISHILSYLR LVGILIASVVIAEIIDLVFMKSIVSHSIGLAIAGVVILIFGQMFNLILAVFEPGIQGARL IYVEFFSKFYHGNGRMFRPFRSQRKYTEDGLDFDKAR
Uniprot No.

Target Background

Function
This protein catalyzes the synthesis of ATP from ADP in the presence of a proton gradient across the membrane.
Database Links

KEGG: tac:Ta0008

STRING: 273075.Ta0008

Protein Families
V-ATPase 116 kDa subunit family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural relationship between subunit I and the peripheral stalk in T. acidophilum ATP synthase?

Subunit I forms a critical attachment point for the peripheral stalk of the T. acidophilum ATP synthase. Research has demonstrated that the EH heterodimer, which forms the peripheral stalk, remains attached to subunit I of the A₀ domain during biochemical manipulations. The peripheral stalk consists of a heterodimeric EH complex that includes an N-terminal coiled-coil domain (ENT2HNT) and a C-terminal globular domain (ECT1HCT) . The interaction between the peripheral stalk and subunit I appears to be quite strong, with reports indicating an affinity of approximately 150 nM between the E. hirae A-ATPase EH and the N-terminal domain of subunit I (INT) . This structural arrangement is consistent with co-purification results in T. thermophilus, where EH and subunit I are recovered together upon chemical dissociation from the K-ring .

How does subunit I contribute to the rotary mechanism of the ATP synthase complex?

Subunit I is an integral component of the membrane-embedded A₀ domain that anchors the peripheral stalk, a critical element in the stator that counteracts the torque generated during rotational catalysis. The C-terminal domain of the EH heterodimer (ECT1HCT) interacts with the N-terminal region of the B subunit, while the N-terminal domain extends down to interact with subunit I . This arrangement allows the peripheral stalk to transmit the counter-torque necessary for efficient energy conversion during ATP synthesis or hydrolysis.

In the rotary mechanism of V/A-ATPases, ATP hydrolysis in the V₁ domain drives the rotation of the central rotor. This mechanical process involves three catalytic sites in the three AB dimers (AB open, AB semi, and AB closed), which undergo conformational changes during ATP binding, hydrolysis, and product release . Subunit I helps maintain the structural integrity necessary for this rotary mechanism to function properly.

What experimental approaches are recommended for initial characterization of recombinant subunit I?

For initial characterization of recombinant T. acidophilum ATP synthase subunit I, a multi-method approach is recommended:

  • Expression optimization: Use thermophilic expression systems compatible with the thermostable nature of T. acidophilum proteins. Monitor expression using SDS-PAGE and Western blotting.

  • Structural analysis: Employ circular dichroism (CD) spectroscopy to assess secondary structure content and proper folding of the recombinant protein.

  • Interaction studies: Use pull-down assays to verify binding to the EH heterodimer. Previous research indicates that the interaction between EH and subunit I is strong and specific, with a reported affinity of approximately 150 nM .

  • Functional reconstitution: Incorporate purified recombinant subunit I into liposomes along with other ATP synthase components to assess functional assembly.

  • Thermal stability testing: Given T. acidophilum's thermophilic nature, verify thermal stability of the recombinant protein using differential scanning calorimetry.

How can cryo-EM be optimized for analyzing subunit I within the complete ATP synthase complex?

Optimizing cryo-EM analysis of subunit I within the T. acidophilum ATP synthase requires several specialized approaches:

  • Sample preparation: Ensure high purity (>95%) of the reconstituted complex with minimal aggregation. Use detergents suitable for thermophilic membrane proteins (e.g., DDM or LMNG at optimized concentrations).

  • Grid optimization: Test multiple grid types and freezing conditions to prevent preferred orientation of particles. Recent time-resolved cryo-EM snapshot analysis of V/A-ATPase has yielded valuable structural information about the complex's rotary mechanism .

  • Data collection parameters: Use energy filters and phase plates to enhance contrast for better visualization of the membrane domain containing subunit I.

  • Image processing: Implement focused classification and local refinement strategies to resolve the membrane domain with higher resolution. This approach has proven effective for identifying different nucleotide-bound states in the V₁ domain .

  • Cross-linking: Consider mild cross-linking protocols to stabilize the complex while preserving native interactions, particularly the connection between subunit I and the peripheral stalk.

What NMR spectroscopy approaches can elucidate the interaction between subunit I and the peripheral stalk?

NMR spectroscopy offers powerful tools for studying the interaction between subunit I and the peripheral stalk in atomic detail:

  • Chemical shift perturbation (CSP) mapping: Similar to approaches used to study the interaction between ECT1HCT and BNT, ¹⁵N-labeled subunit I can be titrated with unlabeled EH complex while monitoring changes in ¹⁵N-HSQC spectra . This would identify residues experiencing significant chemical shift changes upon binding.

  • Transferred NOE experiments: These can provide distance constraints between interacting residues in cases where direct observation of the complex is challenging.

  • Paramagnetic relaxation enhancement (PRE): Strategic placement of paramagnetic probes on the EH complex can help map the binding interface with subunit I through distance-dependent relaxation effects.

  • Segmental isotopic labeling: For larger protein domains, selective labeling of specific segments can simplify spectra and focus analysis on regions of interest.

  • Secondary structure prediction: As done with other ATP synthase components, secondary structure prediction combined with NMR chemical shift index (CSI) analysis can guide structural interpretation .

Analysis of binding affinities should be conducted by fitting chemical shift changes to a single-site binding model, similar to methods that determined a Kd of ~150 nM for the EH-INT interaction in related systems .

What expression systems yield optimal results for recombinant T. acidophilum subunit I?

The selection of an appropriate expression system for recombinant T. acidophilum subunit I requires careful consideration of several factors:

Expression SystemAdvantagesChallengesRecommendations
E. coli BL21(DE3)High yield, simplicityPotential folding issues, inclusion bodiesUse with fusion tags (MBP, SUMO); optimize growth at 30°C
E. coli C41/C43Designed for membrane proteinsLower yieldsTest various induction conditions
Thermophilic bacteriaNative-like folding environmentExpression protocol complexityConsider Thermus thermophilus systems
Cell-free systemsAvoids toxicity issuesHigher cost, optimization requiredUseful for initial screening
Yeast systemsPost-translational modificationsLonger development timeConsider for complex assembly studies

For optimal results, I recommend employing a dual approach:

  • Initial screening in E. coli C41/C43 strains with an N-terminal His10-SUMO tag to enhance solubility

  • Secondary validation in a thermophilic expression system to ensure proper folding and stability

The expression construct should include the complete coding sequence with careful consideration of the N-terminal domain, where sequence variation has been observed in related ATP synthase subunits .

What are the critical factors for successful reconstitution of ATP synthase with recombinant subunit I?

Successful reconstitution of functional ATP synthase incorporating recombinant subunit I depends on several critical factors:

  • Protein quality: Ensure high purity (>95%) and proper folding of all components. Verify the structural integrity of subunit I using CD spectroscopy and thermal stability assays.

  • Lipid composition: Optimize the lipid environment to mimic T. acidophilum membrane characteristics:

    • Test archaeal lipid extracts or synthetic archaeol-based lipids

    • Maintain acidic pH (pH 2-3) to replicate T. acidophilum's natural environment

    • Consider lipid:protein ratios between 50:1 and 100:1 (w/w)

  • Assembly protocol:

    • Begin with reconstitution of the A₀ domain (including subunit I) into liposomes

    • Add the V₁ sector (containing the AB catalytic subunits) in a separate step

    • Include the peripheral stalk EH heterodimer to ensure proper connection between domains

  • Functional verification: Confirm successful reconstitution through:

    • ATP hydrolysis assays at elevated temperatures (55-60°C)

    • Proton pumping assays using pH-sensitive fluorescent dyes

    • Structural verification via negative-stain EM

  • Stability optimization: Include stabilizers relevant to thermophilic proteins:

    • Test various divalent cations (Mg²⁺, Ca²⁺)

    • Consider osmolytes like trehalose or glycerol

What assays can differentiate between properly assembled and misassembled complexes containing recombinant subunit I?

Distinguishing between properly assembled and misassembled ATP synthase complexes containing recombinant subunit I requires complementary assays:

  • ATP hydrolysis activity: Measure the rate of ATP hydrolysis at 55-60°C (optimal for T. acidophilum). Properly assembled complexes should show higher specific activity and appropriate temperature dependence.

  • Proton pumping assays: Reconstitute the complex into liposomes containing pH-sensitive fluorescent dyes. Properly assembled complexes will demonstrate ATP-dependent proton translocation.

  • Binding affinity measurements: Quantify the interaction between subunit I and the EH peripheral stalk components using microscale thermophoresis or surface plasmon resonance. The affinity should be in the nanomolar range (~150 nM) based on related systems .

  • Structural integrity analysis: Use limited proteolysis followed by mass spectrometry to identify exposed regions in misassembled complexes. Properly assembled complexes will show characteristic proteolytic patterns.

  • Rotational catalysis assessment: Monitor the rotation of the central rotor using single-molecule techniques with fluorescent probes. Properly assembled complexes will demonstrate the expected 120° rotational steps associated with ATP hydrolysis .

How do mutations in conserved residues of subunit I affect the assembly and function of the ATP synthase complex?

Mutations in conserved residues of subunit I can have profound effects on ATP synthase assembly and function:

  • Interface residues: Mutations at the interface with the EH heterodimer can disrupt peripheral stalk attachment. Based on the structural organization of the complex, these interactions are critical for counteracting the torque generated during rotational catalysis .

  • Membrane integration: Mutations in transmembrane helices can affect proper membrane insertion and stability. This may alter proton translocation pathways, particularly if the mutations involve charged residues.

  • Assembly effects: Mutations can disrupt the ordered assembly pathway of the complex. As EH has been shown to remain attached to subunit I during purification , residues involved in this interaction are particularly critical for proper complex formation.

  • Catalytic efficiency: While subunit I is not directly involved in ATP hydrolysis, mutations that affect the structural integrity of the A₀ domain can impact the efficiency of coupling between ATP hydrolysis in the V₁ domain and rotor rotation .

  • Thermal stability: Mutations may alter the thermal stability profile of the protein, which is particularly relevant for a thermophilic organism like T. acidophilum.

A comprehensive mutagenesis approach should target:

  • Conserved residues at the EH interaction interface

  • Residues in transmembrane regions potentially involved in proton translocation

  • Residues at domain interfaces critical for assembly

How have the structure and function of subunit I evolved in extremophilic organisms compared to mesophilic counterparts?

The evolution of subunit I in extremophilic organisms like T. acidophilum reflects adaptations to harsh environmental conditions:

  • Structural adaptations: Extremophilic ATP synthases generally show increased rigidity and stability. In T. acidophilum, this likely involves increased hydrophobic core packing and enhanced ionic interactions to maintain structure at low pH and high temperature.

  • Sequence conservation patterns: Comparative analysis reveals that while the peripheral stalk attachment regions are conserved, transmembrane domains show adaptations specific to acidophilic environments. Sequence alignment of related B subunits has revealed variations in the length of N-termini across species , and similar variations may exist for subunit I.

  • Functional specialization: The ATP synthase of T. acidophilum functions optimally at acidic pH (2-3) and elevated temperatures, reflecting adaptations in proton-binding sites and conformational stability mechanisms.

  • Evolutionary origin: V/A-type ATPases share a common ancestor with F-type ATP synthases, but have evolved distinct mechanisms. The arrangement of subunit I and its interaction with the peripheral stalk represents a specific adaptation in the V/A-type lineage .

  • Comparative analysis with related systems: The reported affinity between E. hirae A-ATPase EH and subunit I (INT) is approximately 150 nM , which differs from the interaction strength in other systems, reflecting evolutionary adaptation to specific environmental niches.

What insights does the rotary mechanism of T. acidophilum ATP synthase provide for understanding energy conversion in extremophilic environments?

The rotary mechanism of T. acidophilum ATP synthase offers unique insights into energy conversion strategies in extremophilic environments:

  • Coupling efficiency: The discrete conformational changes in the V₁ domain coupled with ATP hydrolysis suggest a highly efficient energy conversion process adapted to resource-limited extreme environments.

  • Structural stability: The maintenance of the asymmetric structure of the V₁ domain (composed of AB open, AB semi, and AB closed) regardless of nucleotide binding state indicates a robust mechanism resistant to environmental perturbations.

  • Proton gradient utilization: T. acidophilum thrives in acidic environments with natural proton gradients. Its ATP synthase has evolved to efficiently harness these gradients for ATP synthesis through a specialized rotary mechanism.

  • Nucleotide binding and hydrolysis: The binding of ATP to AB open in the V₂nuc state results in V₃nuc formation before the 120° rotation occurs . This ordered mechanism suggests a carefully regulated process optimized for extreme conditions.

  • Evolutionary significance: The structure and mechanism of T. acidophilum ATP synthase provide evidence for how molecular machines have adapted to function in extreme environments, offering insights into both ancient and specialized metabolic strategies.

A comprehensive understanding of this system contributes to our broader knowledge of bioenergetic principles and may inform the design of biomimetic energy conversion systems optimized for harsh conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.