Recombinant Thermoplasma volcanium Probable cobalamin biosynthesis protein CobD (cobD)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cobalamin Biosynthesis

CobD is a key enzyme in the anaerobic cobalamin biosynthesis pathway, catalyzing the attachment of (R)-1-amino-2-propanol O-2-phosphate (derived from threonine) to adenosylcobyric acid, forming adenosylcobinamide phosphate . This step is essential for assembling the nucleotide loop that coordinates cobalt in the final cobalamin structure.

Comparative Pathway Analysis

FeatureAnaerobic Pathway (e.g., T. volcanium)Aerobic Pathway (e.g., Pseudomonas denitrificans)
Cobalt insertionEarly (first committed step)Late
Oxygen requirementAbsentRequired
Key enzymeCobD/CbiB (EC 6.3.1.10)CobCD

This distinction highlights CobD’s role in extremophiles thriving in low-oxygen environments like hydrothermal vents .

Genomic and Evolutionary Context

T. volcanium’s genome (1.58 Mbp, GC content: 39.9%) encodes 1,543 protein-coding genes, including cobD (locus TV0030) . Key genomic insights:

  • HU histone-like protein: Shares homology with bacterial DNA-binding proteins, suggesting evolutionary links between archaea and bacteria .

  • Thermostability adaptations: Reduced heme biosynthesis pathways and increased purine-pyrimidine clustering correlate with its 60°C optimum growth temperature .

Research Applications

Recombinant CobD is utilized in:

  • Enzyme kinetics studies: Investigating substrate specificity and metal cofactor interactions .

  • Extremophile biochemistry: Analyzing protein stability under high-temperature, acidic conditions (pH 0.5–6.5) .

  • Structural biology: Crystallization trials to resolve 3D architecture .

Comparative Analysis with Homologs

CobD homologs in other archaea share functional conservation but exhibit sequence divergence:

OrganismGene IDProtein LengthIdentity to T. volcanium CobD
Methanocaldococcus jannaschiiMJ1314Partial~45%
Pyrococcus kodakaraensisTK0863Partial~42%
Methanococcus maripaludisMMP_RS04930Full-length~50%

These variations reflect adaptations to distinct ecological niches .

Challenges and Future Directions

  • Thermostability mechanisms: Unresolved structural features enabling CobD function at 60°C .

  • Biotechnological potential: Engineering CobD for industrial B12 production or bioremediation in acidic environments .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
It is advisable to briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. To maintain protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize its implementation.
Synonyms
cobD; TV0030; TVG0029865; Probable cobalamin biosynthesis protein CobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Target Names
cobD
Target Protein Sequence
MIVVLIGALSIDIIFGEPKEYIHPVVFSGRVASAIEGYFRKFDNRFRAGILFSIAVIVLT AIPYFLAVYLSSFILVVYVVVSMVILKTTFSITSMGEHIKLITDSLKKGNIMEARMHLSM IVRRDTSRLNENEISSAAIESIAEGLVDGYITPLFFFVFFGLPGAFIARIINTLDSMYGY KDRKNFEFGRFSAFMDTVINYIPARISWFFITFSSDILNYRSKAIPVRRYIRRFDSVNAG WPIASMASALNLRLEKKGHYIVNDDGYQPGVADIEKSMKIYYLAAYSYIVIFVLPLLVIM AVFL
Uniprot No.

Target Background

Function
This protein catalyzes the conversion of cobyric acid to cobinamide by incorporating aminopropanol onto the F carboxylic group.
Database Links
Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Thermoplasma volcanium and what ecological niche does it occupy?

Thermoplasma volcanium is a moderate thermoacidophilic archaeon naturally found in acidic hydrothermal vents and solfatara fields . It is classified within the phylum Euryarchaeota and family Thermoplasmataceae . This remarkable organism has evolved to thrive in extreme environments characterized by high temperature and acidity. As a facultative anaerobic chemoorganoheterotroph, it can utilize various organic compounds for energy and carbon, with the ability to grow both with and without oxygen . The ecological adaptations of T. volcanium make it a valuable model organism for studying protein stability and function under extreme conditions.

What structural and genomic features make Thermoplasma volcanium unique among archaea?

Thermoplasma volcanium possesses several distinctive features that set it apart from other archaeal species. Most notably, it lacks a cell wall entirely, which is unusual even among extremophiles . Its morphology is dynamic, changing throughout its growth phases – during early logarithmic growth, cells appear in various shapes including coccoid, disc, and club forms measuring approximately 0.2-0.5 micrometers, while later growth phases favor a spherical morphology . The organism is motile via a single flagellum positioned at one polar end of the cell .

Genomically, T. volcanium contains a circular chromosome of 1.58 megabase pairs encoding 1,613 genes, with 1,543 being protein-coding . The genome has a GC content of 39.9%, which is notably lower than its relative Thermoplasma acidophilum by approximately 7% . This genomic architecture provides valuable insights into the molecular adaptations required for thriving in extreme environments.

What is the predicted biochemical function of CobD in the cobalamin biosynthetic pathway?

The probable cobalamin biosynthesis protein CobD in T. volcanium is predicted to function as an L-threonine-O-3-phosphate decarboxylase based on homology with characterized CobD proteins from other organisms. In the canonical cobalamin (vitamin B12) biosynthetic pathway, CobD typically catalyzes the decarboxylation of L-threonine-O-3-phosphate to produce (R)-1-amino-2-propanol O-2-phosphate. This reaction represents a critical step in the assembly of the aminopropanol linker that connects the lower nucleotide loop with the corrin ring in the vitamin B12 molecule.

The archaeal variants of this enzyme are particularly interesting due to potential adaptations that enable functionality under extreme conditions. While direct biochemical characterization of T. volcanium CobD remains limited in the literature, comparative genomic analyses suggest conservation of key catalytic residues essential for phosphate binding and decarboxylation activity.

What heterologous expression systems are most effective for producing functional recombinant T. volcanium CobD?

For expression of thermostable archaeal proteins like T. volcanium CobD, several expression systems have demonstrated varying degrees of effectiveness. The optimal expression system should balance protein yield, solubility, and retention of native enzymatic activity.

For most research applications, the E. coli BL21(DE3) strain with a pET expression system using T7 promoter control provides an excellent starting point. Expression optimization typically involves:

  • Induction at lower temperatures (16-25°C) for extended periods (16-24 hours)

  • Use of specialized fusion tags (SUMO, MBP) to enhance solubility

  • Supplementation with rare codon tRNAs when necessary

  • Co-expression with molecular chaperones to assist folding

What purification strategy yields the highest purity and activity of recombinant T. volcanium CobD?

A multi-step purification approach is recommended to obtain high-purity, active CobD protein:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or TALON resin for His-tagged constructs is highly effective. Buffer conditions should include:

    • 50 mM Tris-HCl, pH 8.0

    • 300 mM NaCl

    • 5-20 mM imidazole in binding buffer

    • 250-300 mM imidazole for elution

    • 1 mM DTT or 2 mM β-mercaptoethanol as reducing agents

  • Intermediate Purification: Ion exchange chromatography (typically Q-Sepharose) can separate the target protein from similarly sized contaminants

  • Polishing Step: Size exclusion chromatography using Superdex 75 or 200 columns in a buffer containing:

    • 25 mM HEPES, pH 7.5

    • 150 mM NaCl

    • 1 mM DTT

    • 10% glycerol for stability

The purification should be conducted at room temperature rather than 4°C to prevent cold-induced denaturation of this thermostable protein. Activity assays should be performed after each purification step to monitor retention of function, with typical final purity exceeding 95% as assessed by SDS-PAGE.

How can the structural integrity and enzymatic activity of purified recombinant CobD be verified?

Multiple complementary approaches should be employed to verify both structural integrity and functional activity:

Structural Integrity Assessment:

  • Circular Dichroism (CD) spectroscopy to evaluate secondary structure elements

  • Thermal shift assays to determine protein stability and melting temperature

  • Dynamic Light Scattering (DLS) to confirm monodispersity and absence of aggregation

  • Limited proteolysis to verify proper folding (properly folded proteins typically show resistance to proteolytic digestion)

Functional Activity Verification:

  • Spectrophotometric assay measuring the decarboxylation of L-threonine-O-3-phosphate by monitoring CO₂ release

  • Coupled enzyme assays tracking the formation of (R)-1-amino-2-propanol O-2-phosphate

  • Isothermal Titration Calorimetry (ITC) to measure substrate binding affinity

  • HPLC or LC-MS analysis of reaction products

A typical enzymatic assay might include:

  • 50 mM HEPES buffer (pH 7.5)

  • 5 mM L-threonine-O-3-phosphate substrate

  • 0.5-5 μM purified CobD enzyme

  • 5 mM MgCl₂ as cofactor

  • Incubation at 55-60°C (optimal temperature for T. volcanium enzymes)

How does the three-dimensional structure of T. volcanium CobD compare to homologous proteins from mesophilic organisms?

While a high-resolution structure of T. volcanium CobD has not been directly reported in the searched literature, structural predictions based on homology modeling suggest several adaptations typical of thermostable proteins. Compared to mesophilic homologs, T. volcanium CobD likely exhibits:

These structural features collectively contribute to enhanced thermostability while maintaining the core catalytic architecture necessary for function. The active site likely contains conserved residues for substrate binding, including positively charged amino acids for phosphate coordination and a catalytic base for decarboxylation.

What experimental approaches can elucidate the catalytic mechanism and substrate specificity of CobD?

Multiple complementary experimental approaches can provide insights into the catalytic mechanism:

  • Site-directed mutagenesis: Systematically alter predicted catalytic residues to assess their contribution to enzyme activity. Key targets would include:

    • Residues coordinating the phosphate group

    • Potential catalytic bases required for decarboxylation

    • Substrate binding pocket residues

  • Alternative substrate testing: Evaluate enzyme activity with substrate analogs to map the structural requirements for catalysis:

    • L-serine-O-3-phosphate

    • D-threonine-O-3-phosphate

    • L-threonine (non-phosphorylated)

  • pH-rate profile analysis: Determine the optimal pH and identify potential ionizable groups in the active site by measuring enzyme activity across a pH range (typically pH 5-9).

  • Kinetic isotope effects: Utilize isotopically labeled substrates (deuterium or C-13) to identify rate-limiting steps in the reaction mechanism.

  • X-ray crystallography: Obtain structures with bound substrate, product, or substrate analogs to visualize the active site architecture and binding interactions.

  • Molecular dynamics simulations: Model the dynamic behavior of the enzyme-substrate complex to identify transient interactions during catalysis.

How does temperature affect the stability, folding, and activity of T. volcanium CobD?

As a protein from a thermoacidophilic organism, T. volcanium CobD exhibits notable temperature-dependent characteristics:

Stability Profile:

  • Likely maintains structural integrity at temperatures up to 60-70°C

  • Exhibits higher conformational rigidity at mesophilic temperatures (20-37°C)

  • May display cold-denaturation phenomena below 10°C

Activity-Temperature Relationship:

  • Optimal activity typically observed at 55-65°C

  • Reduced but measurable activity at lower temperatures (30-50°C)

  • Sharp decline in activity above optimal temperature due to protein unfolding

Folding Characteristics:

  • Likely folds properly even when expressed at lower temperatures

  • May require higher temperatures for complete maturation to most active conformation

  • Could exhibit slower unfolding kinetics compared to mesophilic homologs

Temperature-dependent activity studies can be conducted using standard assay conditions while varying the incubation temperature from 30-80°C. The resulting bell-shaped curve typically reveals the temperature optimum and the range of functional stability.

How can recombinant T. volcanium CobD serve as a model for understanding enzyme adaptation to extreme environments?

Recombinant T. volcanium CobD represents an excellent model system for investigating molecular adaptation to extreme environments for several reasons:

  • Comparative Biochemistry: By comparing the biochemical properties of CobD from T. volcanium with homologous proteins from mesophilic and psychrophilic organisms, researchers can identify specific adaptations that enable function under thermoacidophilic conditions. These comparisons can focus on:

    • Substrate binding affinity at different temperatures

    • Catalytic efficiency (kcat/KM) across temperature ranges

    • pH optima and stability boundaries

  • Structure-Function Relationships: Engineering chimeric enzymes by swapping domains between thermophilic and mesophilic CobD variants can identify specific structural elements responsible for thermostability.

  • Evolutionary Analysis: Phylogenetic analysis of CobD sequences across archaea inhabiting diverse environments can reveal convergent evolutionary strategies for environmental adaptation.

  • Biophysical Characterization: Advanced biophysical techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map flexibility and rigidity across the protein structure, correlating these properties with thermostability.

What insights might T. volcanium CobD provide about cobalamin biosynthesis in archaea compared to bacteria?

Studies of T. volcanium CobD can illuminate several aspects of archaeal cobalamin biosynthesis:

  • Pathway Variations: Comparative genomic and biochemical analyses suggest that archaeal cobalamin biosynthesis pathways may differ from bacterial pathways in key steps. CobD research can help elucidate these differences by:

    • Characterizing substrate specificity differences

    • Identifying unique regulatory mechanisms

    • Mapping protein-protein interactions specific to archaeal biosynthetic complexes

  • Evolutionary Implications: The study of CobD can provide insights into the evolutionary history of cobalamin biosynthesis:

    • Did archaeal cobalamin biosynthesis evolve independently?

    • Was it present in the last universal common ancestor (LUCA)?

    • How has horizontal gene transfer shaped the distribution of these pathways?

  • Metabolic Integration: Understanding CobD function helps reveal how cobalamin biosynthesis is integrated with other metabolic pathways in archaea, potentially identifying novel regulatory networks.

  • Environmental Adaptation: Comparing CobD from different archaeal species can show how cobalamin biosynthesis has adapted to diverse extreme environments beyond just high temperatures.

What potential biotechnological applications exist for thermostable CobD enzymes?

The thermostable nature of T. volcanium CobD opens several biotechnological possibilities:

  • Biocatalysis: Thermostable enzymes offer significant advantages in industrial processes:

    • Higher reaction rates at elevated temperatures

    • Reduced risk of microbial contamination

    • Enhanced substrate and product solubility

    • Potential for longer catalyst lifetime

  • Synthetic Biology Applications: CobD could be incorporated into engineered pathways for:

    • Production of vitamin B12 derivatives

    • Synthesis of aminopropanol-containing compounds

    • Development of novel bioactive molecules

  • Biosensor Development: The substrate specificity of CobD could be exploited to develop biosensors for:

    • Detection of phosphorylated amino acids

    • Monitoring specific metabolic pathways

    • Environmental sensing applications

  • Protein Engineering Platform: The robust scaffold of T. volcanium CobD provides an excellent starting point for protein engineering efforts:

    • Creation of enzymes with novel substrate specificities

    • Development of biocatalysts for non-natural reactions

    • Design of thermostable enzyme chimeras with enhanced properties

What strategies can overcome low expression or insolubility issues when producing recombinant T. volcanium CobD?

Researchers encountering expression challenges with T. volcanium CobD can implement several targeted strategies:

  • Codon Optimization: Archaeal genes often contain codons rarely used in E. coli. Custom synthesis of codon-optimized genes can significantly improve expression by:

    • Matching codon usage to the expression host

    • Eliminating rare codons that might cause translational pausing

    • Optimizing mRNA secondary structure near the start codon

  • Fusion Partners: Strategic selection of fusion partners can dramatically improve solubility:

    • SUMO tag: Enhances solubility while allowing native N-terminus after cleavage

    • MBP tag: Highly soluble carrier that can assist folding

    • Thioredoxin (Trx): Promotes disulfide formation and proper folding

  • Expression Conditions Optimization:

    • Temperature reduction to 16-20°C during induction

    • Extended expression time (24-48 hours)

    • Induction at higher cell densities (OD600 of 0.8-1.0)

    • Reduced inducer concentration (0.1-0.5 mM IPTG)

  • Solubilizing Additives:

    • 5-10% glycerol in lysis and purification buffers

    • 0.1-0.5% non-ionic detergents (Triton X-100, NP-40)

    • 50-300 mM arginine or 50-100 mM proline as stabilizing osmolytes

  • Alternative Expression Systems:

    • Cell-free protein synthesis systems

    • Bacillus subtilis or Pseudomonas fluorescens for difficult-to-express proteins

    • Archaeal expression hosts for native-like folding environment

How can researchers distinguish between enzymatic activity of CobD and potential contaminating proteins?

Ensuring that observed enzymatic activity originates from CobD rather than contaminants requires several control experiments and analytical approaches:

  • Negative Controls:

    • Perform activity assays with buffer alone

    • Use purified fractions from expression systems containing empty vector

    • Heat-inactivate purified CobD (95°C for 30 minutes) to serve as a negative control

  • Specificity Verification:

    • Demonstrate activity with specific substrate (L-threonine-O-3-phosphate) but not with structurally related compounds

    • Show dependency on expected cofactors

    • Verify inhibition with known inhibitors of similar enzymes

  • Activity Correlation with Purity:

    • Track specific activity (units/mg protein) throughout purification process

    • Demonstrate that specific activity increases proportionally with purity

    • Perform activity assays on separate fractions from size exclusion chromatography

  • Definitive Verification:

    • Use site-directed mutagenesis to create catalytically inactive variants (mutation of predicted active site residues)

    • Demonstrate that active site mutations eliminate activity while maintaining structural integrity

    • Employ mass spectrometry to confirm reaction products are as expected

What are effective strategies for maintaining long-term stability of purified T. volcanium CobD?

Maintaining long-term stability of purified thermostable enzymes requires careful consideration of storage conditions:

  • Optimal Buffer Composition:

    • 25-50 mM Tris or HEPES buffer (pH 7.5-8.0)

    • 100-200 mM NaCl for ionic strength

    • 1-5 mM DTT or TCEP as reducing agents

    • 10-20% glycerol as cryoprotectant

    • Consider adding 0.1 mM EDTA to chelate metal ions that could catalyze oxidation

  • Storage Temperature Options:

    • -80°C for longest-term storage (aliquot to avoid freeze-thaw cycles)

    • -20°C with 50% glycerol

    • 4°C for short-term storage (up to 1-2 weeks, depending on stability)

    • Room temperature may actually be viable for thermostable variants

  • Lyophilization Protocols:

    • Flash-freeze in liquid nitrogen before lyophilization

    • Include lyoprotectants such as trehalose or sucrose (5-10%)

    • Store lyophilized powder with desiccant at -20°C

  • Stability Assessment:

    • Regularly test activity of stored enzyme preparations

    • Monitor for aggregation using dynamic light scattering

    • Consider adding stabilizing additives like arginine or proline

Storage MethodAdvantagesLimitationsExpected Stability
-80°C (flash frozen)Maintains activity for long periodsFreeze-thaw cycles damaging1-2 years
-20°C in 50% glycerolConvenient, prevents freezing damageSome activity loss over time6-12 months
4°CReady to useLimited shelf life1-4 weeks
Lyophilized powderStable at room temperature, easy shippingRequires reconstitution, some activity loss>2 years

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.