Recombinant Thermosediminibacter oceani Cobalt transport protein CbiM (cbiM)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cobalt Transport

CbiM operates within the CbiMNQO ECF transporter complex:

  • Substrate Specificity: Binds cobalt (Co²⁺) with high specificity (nickel uptake is ~8% of cobalt activity) .

  • ATPase Coupling: CbiM stimulates ATP hydrolysis by the CbiQO ATPase module, independent of cobalt binding .

  • Dynamic Interactions:

    • With CbiN: The auxiliary protein CbiN enhances cobalt transport via loop-loop interactions, facilitating metal insertion into CbiM’s binding pocket .

    • With CbiQ: Phe75 in CbiQ’s TM4 helix docks into CbiM’s substrate site, a conserved feature in cobalt/nickel transporters .

Key Domains and Mutational Analysis

  • L1 Loop: Acts as a substrate gate; deletions impair cobalt uptake .

  • SM1 Domain: Hydrophobic residues (Ala46, Ala50) stabilize interactions with CbiQ. Mutations to Trp reduce activity .

Conformational Dynamics

  • Inward-Open State: Observed in CbiMQO structures, enabling cytoplasmic substrate release .

  • ATP-Driven Changes: ATP binding induces CbiO subunit closure, triggering rotational movements in CbiQ and CbiM .

Production and Applications

  • Expression Systems: Optimized in E. coli for high yield (>85% purity) .

  • Stability: Lyophilized powder retains activity at -80°C; glycerol prevents aggregation during storage .

  • Research Use:

    • Mechanistic studies of ECF transporters .

    • Metal homeostasis in extremophiles .

Comparative Analysis of CbiM Homologs

CbiM orthologs in Bacillus tusciae, Clostridium cellulovorans, and Rhodobacter capsulatus share >60% sequence identity, underscoring evolutionary conservation in cobalt transport . Functional divergence is noted in pH and salinity optima across species .

Critical Research Findings

  • ATPase Stimulation: CbiMQO subcomplex exhibits ATP turnover (k<sub>cat</sub> = 9.3 min⁻¹), 3.7-fold higher than CbiQO alone .

  • Essential Residues: Phe75Ala mutation reduces cobalt uptake by 80%, highlighting its role in substrate specificity .

  • CbiN Dependency: Transport activity drops 90% in CbiN-deficient strains, emphasizing its regulatory role .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate any preferences when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
cbiM; Toce_0304; Cobalt transport protein CbiM; Energy-coupling factor transporter probable substrate-capture protein CbiM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-244
Protein Length
full length protein
Species
Thermosediminibacter oceani (strain ATCC BAA-1034 / DSM 16646 / JW/IW-1228P)
Target Names
cbiM
Target Protein Sequence
MHVMEGFLPFKWCLLWYSIYIPFLMAGLIYIKKNIAEEPSKKILLGFAGAFVFALSALKL PSVAGSSSHPTGIGLGAILLGPLPMAVIGGIVLLFQALLLAHGGITTLGANAFSMAVAGS FAAYGLYKVAGRVGLSKSASVFLGAASGDLMTYIITSLQLALAFPASRGGVAASFAGFSG IFAVTQLPLAIGEGILTVIVLNLLEIHAGVVVGRLVKGASNDEG
Uniprot No.

Target Background

Function
CbiM is part of the energy-coupling factor (ECF) transporter complex CbiMNOQ, involved in cobalt import.
Database Links
Protein Families
CbiM family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant T. oceani CbiM protein?

For optimal stability and activity retention of recombinant T. oceani CbiM protein, the following storage conditions are recommended:

Storage PeriodTemperaturePreparationAdditional Notes
Long-term storage-20°C to -80°CAliquotedAvoid repeated freeze-thaw cycles
Working stock (≤1 week)4°CReconstitutedMonitor for activity loss
Shipping/TransportLyophilized formN/AReconstitute upon receipt

The protein is typically stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . For reconstitution, it is recommended to:

  • Briefly centrifuge the vial prior to opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50% is standard)

  • Aliquot for long-term storage to minimize freeze-thaw cycles

This approach maintains protein stability and prevents aggregation or degradation that could compromise experimental results.

How does T. oceani CbiM compare with CbiM proteins from other bacterial species?

When comparing T. oceani CbiM with homologous proteins from other bacterial species, several notable differences and similarities emerge:

SpeciesProtein LengthSequence SimilarityFunctional DifferencesEcological Context
T. oceani224 aa (21-244)Reference sequenceAdapted to thermophilic conditionsDeep sea sediments, thermophilic
Halobacterium salinarum220 aa (1-220)Moderate similarityAdapted to halophilic conditionsHypersaline environments

The CbiM protein from T. oceani shows key adaptations to its thermophilic lifestyle, with an optimal growth temperature of 68°C, compared to homologs from other bacteria . When aligned with the Halobacterium salinarum CbiM protein, there are conserved domains related to cobalt transport function, but significant differences in amino acid composition that likely reflect adaptation to their respective extreme environments .

The T. oceani protein appears to have evolved specific thermostable properties that maintain functional integrity at temperatures between 52-76°C, in line with the organism's natural deep sea sediment habitat . These adaptations make it particularly interesting for studies on protein thermostability and metal transport under extreme conditions.

What experimental approaches are most effective for studying the kinetics of cobalt transport by recombinant T. oceani CbiM?

Investigating the kinetics of cobalt transport by recombinant T. oceani CbiM requires specialized experimental designs that account for both the thermophilic nature of the protein and its membrane-associated function. The following methodological approaches are recommended:

  • Reconstituted Proteoliposome Assays:

    • Incorporate purified recombinant CbiM into synthetic liposomes

    • Create a cobalt concentration gradient across the membrane

    • Monitor transport using either:

      • Radioactive 57Co or 60Co tracers

      • Fluorescent cobalt-sensitive probes (e.g., Fluozin-1)

    • Perform measurements at elevated temperatures (60-70°C) to match T. oceani's optimal growth conditions

  • Isothermal Titration Calorimetry (ITC):

    • Determine binding affinity (Kd) of Co2+ to purified CbiM

    • Measure thermodynamic parameters (ΔH, ΔG, ΔS)

    • Compare with other divalent cations to assess specificity

    • Perform at varying temperatures to establish the thermodynamic profile

  • Surface Plasmon Resonance (SPR):

    • Immobilize His-tagged CbiM on Ni-NTA sensor chips

    • Measure real-time binding kinetics (kon and koff) of cobalt ions

    • Determine temperature-dependent kinetic parameters

When comparing these methods, proteoliposome assays provide the most physiologically relevant data but are technically challenging. ITC and SPR offer more precise kinetic and thermodynamic parameters but may not fully represent the native membrane environment. For comprehensive characterization, a combination of these approaches is recommended.

What are the critical considerations for optimizing heterologous expression of T. oceani CbiM in E. coli?

Optimizing the heterologous expression of Thermosediminibacter oceani CbiM in E. coli presents several challenges due to the thermophilic origin of the protein and its membrane-associated nature. The following critical considerations should be addressed:

  • Codon Optimization:

    • T. oceani has a G+C content of 46.3±0.7% , which differs from E. coli

    • Analyze codon usage and optimize the cbiM gene sequence for E. coli expression

    • Consider using strains with rare codon tRNAs (e.g., Rosetta)

  • Expression System Selection:

    Expression SystemAdvantagesDisadvantagesOptimal for CbiM
    pET with T7 promoterHigh expression levelsPotential inclusion body formationGood starting point with reduced temperature
    pBAD (arabinose-inducible)Tight regulation, reduced toxicityLower yieldsUseful if protein is toxic to E. coli
    Cold-shock vectorsImproved folding at lower temperaturesSlower growthMay help with membrane protein folding
  • Membrane Protein Expression Strategies:

    • Use specialized E. coli strains (C41/C43) designed for membrane protein expression

    • Consider fusion partners that enhance membrane targeting (e.g., MBP, SUMO)

    • Incorporate specific membrane-targeting sequences if necessary

  • Induction Conditions:

    • Lower induction temperature (16-25°C) to slow expression and improve folding

    • Reduce inducer concentration (e.g., 0.1-0.5 mM IPTG instead of 1 mM)

    • Extend expression time (overnight or longer) at lower temperatures

  • Extraction and Purification:

    • Select appropriate detergents for membrane protein solubilization (e.g., DDM, LDAO)

    • Optimize lysis conditions to maintain the native structure

    • Consider on-column refolding during affinity purification if inclusion bodies form

When implementing these strategies, it's important to verify protein functionality after purification, as proper folding is crucial for activity. Circular dichroism spectroscopy can help confirm secondary structure integrity, especially considering the thermophilic nature of the native protein.

How can researchers effectively analyze the interaction between T. oceani CbiM and other components of the cobalt transport system?

Analyzing the interactions between T. oceani CbiM and other components of the cobalt transport system requires a multifaceted approach that addresses both structural and functional aspects of these protein-protein interactions. The following methodological framework is recommended:

  • Co-expression and Co-purification Studies:

    • Co-express CbiM with its known transport complex partners (likely CbiQ, CbiO, and CbiN)

    • Utilize different affinity tags for each component

    • Perform tandem affinity purification to isolate intact complexes

    • Analyze complex formation by size-exclusion chromatography

  • Protein-Protein Interaction Mapping:

    • Apply crosslinking mass spectrometry (XL-MS) to identify interaction interfaces

    • Perform hydrogen-deuterium exchange mass spectrometry (HDX-MS) to detect conformational changes upon complex formation

    • Use bacterial two-hybrid or split-GFP assays to verify interactions in vivo

  • Functional Reconstitution:

    • Reconstitute various combinations of the transport components in liposomes

    • Measure cobalt transport activity to determine the minimal functional unit

    • Compare activity metrics:

    ComponentsTransport RateSubstrate AffinityTemperature Optimum
    CbiM aloneBaselineBaselineBaseline
    CbiM + CbiNX% changeY% changeZ°C change
    CbiM + CbiQ + CbiOX% changeY% changeZ°C change
    Complete complexX% changeY% changeZ°C change
  • Structural Biology Approaches:

    • Attempt cryo-EM of the reconstituted complex

    • Use computational docking informed by crosslinking constraints

    • Consider native mass spectrometry to determine stoichiometry and stability of complexes

  • Mutational Analysis:

    • Create site-directed mutations at predicted interface residues

    • Assess the impact on complex formation and transport activity

    • Use these data to refine structural models

By integrating these approaches, researchers can build a comprehensive model of how T. oceani CbiM functions within its transport complex, especially considering the unique adaptations this protein may have for functioning in thermophilic conditions . This information can provide valuable insights into cobalt transport mechanisms in extremophiles and potentially inform biotechnological applications.

What are the recommended protocols for assessing the stability of T. oceani CbiM under different experimental conditions?

The thermophilic nature of Thermosediminibacter oceani CbiM presents unique considerations when assessing protein stability. The following protocols are recommended for comprehensive stability assessment:

  • Thermal Stability Analysis:

    • Differential Scanning Calorimetry (DSC):

      • Temperature range: 25-100°C

      • Scan rate: 1°C/min

      • Buffer: Same as storage buffer (Tris/PBS, pH 8.0)

    • Thermal Shift Assays (TSA):

      • Use SYPRO Orange or similar fluorescent dye

      • Monitor unfolding transition temperatures

      • Test various buffer conditions simultaneously

      • Expected Tm for T. oceani CbiM: likely 65-80°C based on organism growth temperature

  • pH Stability Profile:

    pH RangeBuffer SystemMonitoring MethodExpected Stability
    5.0-6.0MESActivity/CD spectroscopyModerate
    6.0-7.0PIPES/MOPSActivity/CD spectroscopyGood
    7.0-8.0HEPES/TrisActivity/CD spectroscopyOptimal
    8.0-9.0Tris/CAPSActivity/CD spectroscopyGood
    9.0-10.0CAPSActivity/CD spectroscopyModerate
  • Chemical Stability Assessment:

    • Detergent compatibility testing:

      • Screen various detergents (DDM, LDAO, OG, etc.)

      • Monitor protein aggregation by dynamic light scattering

      • Assess structural integrity by circular dichroism

    • Denaturant resistance:

      • Urea and guanidinium chloride denaturation curves

      • Determine ΔG of unfolding

      • Compare with mesophilic CbiM homologs

  • Long-term Storage Stability:

    • Time-course analysis under recommended storage conditions

    • Periodic activity assessment

    • SEC-MALS to detect aggregation

    • SDS-PAGE to monitor degradation

  • Functional Assay for Stability Verification:

    • Cobalt binding assay:

      • Intrinsic tryptophan fluorescence quenching upon Co2+ binding

      • ITC measurements at different time points and conditions

      • Correlate structural stability with functional capacity

When implementing these protocols, it is critical to include appropriate controls, especially considering the thermostable nature of this protein. Samples should be compared at both the protein's physiological temperature range (60-70°C) and standard laboratory conditions to properly contextualize stability data .

How can researchers effectively troubleshoot issues with recombinant CbiM protein activity loss?

Troubleshooting activity loss in recombinant T. oceani CbiM requires a systematic approach to identify the root causes. The following decision-tree methodology addresses common issues:

  • Expression and Purification Issues:

    • Problem: Low activity in freshly purified protein

    • Diagnostic Approach:

      • Verify expression temperature (excessive heat during purification may denature even thermostable proteins)

      • Check imidazole concentration in elution buffers (high concentrations can affect metal binding)

      • Assess protein folding by circular dichroism

    • Solutions:

      • Optimize purification to maintain native conformation

      • Include stabilizing agents (glycerol, specific ions) in buffers

      • Consider on-column refolding protocols if misfolding is detected

  • Storage-Related Activity Loss:

    • Problem: Activity decreases over storage time

    • Diagnostic Approach:

      • Monitor protein aggregation states by DLS or native PAGE

      • Check for proteolytic degradation by SDS-PAGE

      • Assess oxidation of critical residues by mass spectrometry

    • Solutions:

      • Add additional protease inhibitors

      • Include reducing agents if oxidation is detected

      • Optimize glycerol concentration (typically 50%)

      • Consider flash-freezing in liquid nitrogen rather than slow freezing

  • Functional Assay Optimization:

    • Problem: Variable activity results between assays

    • Diagnostic Approach:

      • Verify temperature control (especially important for thermophilic proteins)

      • Check pH stability during the assay

      • Assess cobalt concentration and potential competing ions

    • Solutions:

      • Pre-equilibrate all reagents to optimal temperature

      • Use temperature-stable pH buffers

      • Ensure high-purity metal salts for binding/transport studies

  • Systematic Activity Recovery Assessment:

    InterventionSuccess RateImplementation ComplexityVerification Method
    Buffer optimizationHighModerateFunctional assay
    Additive screeningModerateHighDSF/functional assay
    Refolding protocolsLow-moderateHighCD/functional assay
    Fresh preparationHighModerateDirect comparison
  • Special Considerations for Thermostable Proteins:

    • T. oceani CbiM may require higher temperatures (60-70°C) for optimal activity assessment

    • Standard laboratory temperatures may not reflect true activity potential

    • Consider the natural ionic strength of the deep-sea environment when designing buffers

Implementing this troubleshooting framework allows for systematic identification and resolution of common issues affecting recombinant T. oceani CbiM activity, enabling more reliable and reproducible experimental outcomes.

What advanced spectroscopic methods are most informative for studying conformational changes in T. oceani CbiM during cobalt binding?

Studying conformational changes in thermophilic membrane proteins like T. oceani CbiM during cobalt binding requires specialized spectroscopic approaches. The following methods provide complementary insights into the structural dynamics of this process:

  • Tryptophan Fluorescence Spectroscopy:

    • Exploit intrinsic fluorescence of tryptophan residues in CbiM

    • Monitor changes in emission spectra (typically 300-400 nm) upon cobalt binding

    • Advantages:

      • Label-free approach

      • Can be performed at elevated temperatures (60-70°C)

      • Highly sensitive to local environment changes

    • Experimental design:

      • Excitation at 280-295 nm

      • Titrate cobalt in nanomolar to micromolar range

      • Control for direct quenching effects with non-binding mutants

  • Circular Dichroism (CD) Spectroscopy:

    • Far-UV CD (190-250 nm): Monitor secondary structure changes

    • Near-UV CD (250-350 nm): Detect tertiary structure alterations

    • Thermal CD scans: Assess stability differences with/without cobalt

    • Data analysis:

      • Deconvolution of spectra to quantify α-helix, β-sheet, and random coil content

      • Compare apo vs. cobalt-bound states at various temperatures

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Measures solvent accessibility changes upon ligand binding

    • Protocol modifications for thermophilic membrane proteins:

      • Perform exchange at physiologically relevant temperatures (60-70°C)

      • Optimize detergent conditions to maintain native structure

      • Use rapid cooling to "freeze" the exchange at designated timepoints

    • Data interpretation:

      • Regions showing decreased exchange likely participate in cobalt binding

      • Distant regions with altered exchange patterns indicate allosteric effects

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Site-directed spin labeling of strategically placed cysteine residues

    • Measure distances between labels and their changes upon cobalt binding

    • Particularly powerful for mapping conformational changes in transmembrane domains

    • May require:

      • Introduction of cysteine mutations at key positions

      • Verification that mutations don't disrupt function

      • Special considerations for the paramagnetic properties of cobalt

  • Förster Resonance Energy Transfer (FRET):

    • Engineer pairs of fluorophores at strategic locations

    • Monitor distance changes during cobalt binding events

    • Can be performed with purified protein in detergent micelles or reconstituted in liposomes

    • Time-resolved measurements can capture kinetic aspects of conformational changes

Expected observations based on homologous proteins:

When implementing these methods, it's essential to consider the thermophilic nature of T. oceani CbiM and ensure experimental conditions reflect its native environment as closely as possible .

How do the unique features of T. oceani CbiM contribute to its thermostability while maintaining cobalt transport function?

The thermostability of T. oceani CbiM represents a fascinating adaptation that allows this protein to function optimally in high-temperature environments while preserving its essential cobalt transport capabilities. Several structural features likely contribute to this dual functionality:

These adaptive features allow T. oceani CbiM to maintain its fundamental cobalt transport function at temperatures between 52-76°C, with optimal activity around 68°C, matching the organism's growth requirements . This remarkable adaptation makes it an excellent model for studying how membrane transporters can evolve to function in extreme environments while preserving their core functional mechanisms.

What are the critical residues in T. oceani CbiM responsible for cobalt specificity, and how do they compare with other metal transporters?

The cobalt specificity of T. oceani CbiM is determined by specific amino acid residues that create a selective binding environment for Co2+ ions. Based on sequence analysis and comparison with related transporters, the following residues and structural elements are likely critical for this function:

  • Comparative Analysis of Metal Selectivity Determinants:

    Transporter TypeKey Binding ResiduesCoordination GeometryMetal Selectivity
    T. oceani CbiMHis, Asp, Met (predicted)Likely octahedralCo2+ >> Ni2+, Zn2+
    NiCoT familyHis, Asp, GluSquare planar/octahedralNi2+ ≥ Co2+ >> Zn2+
    ZupT familyHis, Asp, SerTetrahedralZn2+ >> Co2+, Cd2+
    CorA familyAsp, GluOctahedralMg2+ >> Co2+, Ni2+
  • Structural Determinants of Selectivity:
    The specificity for cobalt likely involves:

    • Precise spacing between coordinating residues

    • Cavity size that accommodates cobalt's ionic radius (0.74Å for high-spin Co2+)

    • Charge distribution in the binding pocket

    • Possible second-shell interactions that fine-tune selectivity

  • Thermostable Adaptations in the Binding Site:
    T. oceani CbiM likely features:

    • More rigid binding pocket architecture to maintain geometry at high temperatures

    • Additional stabilizing interactions surrounding the binding site

    • Possible hydrophobic gating mechanisms for controlled access to binding site

  • Mutagenesis Strategy for Functional Verification:
    To experimentally verify these predictions, a strategic mutagenesis approach would target:

    Target Residue TypeMutation StrategyExpected EffectValidation Method
    Primary coordinationHis→AlaAbolished bindingITC, transport assays
    Secondary coordinationAsp→AsnReduced affinityITC, transport assays
    Selectivity filterConserved→Non-conservedAltered metal preferenceCompetition assays
    Thermostability elementsAdd/remove stabilizing interactionsChanged temperature profileThermal stability assays
  • Evolutionary Conservation Analysis:
    Sequence alignment between T. oceani CbiM and homologs from diverse bacteria reveals:

    • Highly conserved metal-binding residues across phylogeny

    • Variable regions that may contribute to thermostability

    • Conservation patterns that distinguish cobalt transporters from other metal transporters

This detailed understanding of the structure-function relationship in T. oceani CbiM provides insights not only into cobalt transport mechanisms but also into how metal selectivity is maintained in extremophilic organisms. The thermostable nature of this protein makes it particularly valuable for biotechnological applications requiring robust metal transport capabilities.

What structural changes might occur in T. oceani CbiM during the complete transport cycle, and how can these be experimentally captured?

Understanding the structural dynamics of T. oceani CbiM throughout the complete transport cycle requires consideration of the protein's likely conformational states and the experimental approaches capable of capturing these transitions. Based on current knowledge of ECF transporters and membrane transport mechanisms:

  • Predicted Conformational States in the Transport Cycle:
    The CbiM-mediated cobalt transport likely involves multiple distinct conformational states:

    Transport StagePredicted ConformationFunctional Significance
    Apo state (outward-facing)Open substrate binding site accessible from periplasmReady to capture extracellular cobalt
    Cobalt-bound (outward-facing)Closed around cobalt ion with subtle domain movementsSubstrate recognition and initial binding
    Transition stateMajor conformational rearrangementTranslocation initiation
    Inward-facing (with cobalt)Access to cytoplasmic space, weakened cobalt bindingPreparation for substrate release
    Cobalt releaseLocal conformational changes in binding siteSubstrate delivery to cytoplasm
    Reset stateReturn to outward-facing conformationPreparation for next transport cycle
  • Experimental Strategies to Capture Conformational Dynamics:

    a. Time-Resolved Cryo-EM with Substrate Trapping:

    • Rapid mixing of protein with cobalt followed by vitrification at defined time points

    • Use of cobalt analogs or ATP analogs (if ATP-dependent) to trap intermediate states

    • Computational classification of particles to identify discrete conformational states

    • Benefits: Direct visualization of structural changes at near-atomic resolution

    • Challenges: Requires high protein stability and homogeneity; difficult to trap short-lived intermediates

    b. Biophysical Approaches with Site-Specific Probes:

    • Double electron-electron resonance (DEER) spectroscopy with strategically placed spin labels

    • Single-molecule FRET with fluorophore pairs at key domain interfaces

    • Systematic mapping of distances between labeled sites in different transport states

    • Benefits: Can detect dynamic changes in solution; applicable to membrane-embedded protein

    • Challenges: Requires careful selection of labeling sites; potential disruption of function

    c. Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) with Millisecond Quenching:

    • Time-resolved HDX-MS to monitor solvent accessibility changes

    • Comparison between apo, substrate-bound, and post-transport states

    • Benefits: Can identify regions undergoing conformational changes without modification

    • Challenges: Lower spatial resolution; challenging with membrane proteins

  • Integration with Computational Approaches:

    Computational MethodApplication to T. oceani CbiMExpected Insights
    Molecular Dynamics SimulationsSimulate full transport cycle in membraneEnergetics of conformational transitions
    Targeted Molecular DynamicsGuide protein between known endpointsPathway of conformational changes
    Normal Mode AnalysisIdentify intrinsic flexibilityMajor collective motions relevant to transport
    Markov State ModelingIntegrate experimental data pointsComplete energy landscape of the transport cycle
  • Specific Adaptations for T. oceani CbiM:
    Given the thermophilic nature of this protein, experimental approaches must consider:

    • Performing experiments at elevated temperatures (60-70°C) when possible

    • Accounting for potentially faster kinetics at higher temperatures

    • Understanding how thermostability might impact conformational flexibility

    • Comparing with mesophilic homologs to identify thermophile-specific mechanics

  • Functional Correlation with Structural Changes:

    • Develop transport assays that can be synchronized with structural studies

    • Correlate rates of conformational change with transport kinetics

    • Identify rate-limiting steps in the transport cycle

By integrating these experimental approaches, researchers can build a comprehensive model of how T. oceani CbiM undergoes conformational changes during cobalt transport. This would provide fundamental insights into how membrane transporters function in extremophilic organisms and how structural dynamics are adapted to high-temperature environments.

How might the thermostable properties of T. oceani CbiM be utilized for biotechnological applications?

The thermostable properties of Thermosediminibacter oceani CbiM offer several promising avenues for biotechnological applications. The protein's ability to maintain structural integrity and function at elevated temperatures (optimally around 68°C) presents unique advantages for various technological innovations:

  • Biosensor Development for Cobalt Detection:
    The specific cobalt-binding properties of T. oceani CbiM can be exploited to create thermostable biosensors for:

    • Environmental monitoring of cobalt contamination in industrial settings

    • Detection of cobalt in geological samples

    • Quality control in metallurgical processes

    Such biosensors could operate reliably in harsh conditions where conventional protein-based sensors would denature. Potential implementation approaches include:

    • Surface immobilization on electrodes for electrochemical detection

    • Coupling with fluorescent reporters for optical sensing

    • Integration into field-deployable microfluidic devices

  • Protein Engineering Platform:
    The natural thermostability of T. oceani CbiM provides an excellent scaffold for protein engineering:

    Engineering GoalApproachPotential Application
    Metal specificity modificationBinding site mutationsSensors/sequestration for different metals
    Stability enhancementDirected evolution under extreme conditionsUltra-robust biotechnological tools
    Fusion protein creationCbiM as a thermostable domain in fusion constructsHeat-resistant enzyme complexes
    Transport rate optimizationTargeted mutagenesis of key residuesEnhanced metal recovery systems
  • Bioremediation of Metal-Contaminated Environments:
    Engineered systems incorporating T. oceani CbiM could:

    • Selectively sequester cobalt from contaminated soils or water

    • Function effectively in high-temperature industrial effluents

    • Maintain activity in challenging environmental conditions

    • Be incorporated into thermophilic bacterial systems for whole-cell bioremediation

  • Industrial Catalyst Regeneration:
    Many industrial catalysts require cobalt as a cofactor. T. oceani CbiM-based systems could:

    • Selectively recover cobalt from spent catalyst materials

    • Function in the high-temperature environments typical of many industrial processes

    • Provide a sustainable approach to metal recycling in catalyst manufacturing

  • Thermostable Membrane Protein Production Platform:
    The successful expression and purification of T. oceani CbiM provides valuable protocols for:

    • Heterologous production of other thermostable membrane proteins

    • Development of optimized detergent systems for thermophilic membrane protein solubilization

    • Creation of thermostable proteoliposome systems for functional studies

  • Fundamental Research Applications:
    Beyond direct biotechnological use, T. oceani CbiM serves as:

    • A model system for understanding membrane protein thermostability

    • A platform for investigating metal transport mechanisms under extreme conditions

    • A comparative system to study evolutionary adaptations to thermophilic environments

The unique combination of cobalt transport specificity and thermostability makes T. oceani CbiM particularly valuable for applications requiring both metal selectivity and resistance to harsh conditions. Future development will likely focus on optimizing expression systems, engineering enhanced variants with desired properties, and developing practical applications that leverage these exceptional characteristics.

What are the most promising research directions for understanding the evolutionary adaptations of metal transporters in extremophiles?

The study of metal transporters in extremophiles, exemplified by T. oceani CbiM, opens several promising research directions for understanding evolutionary adaptations to extreme environments. These approaches combine molecular, structural, and ecological perspectives:

  • Comparative Genomics and Phylogenomics:

    • Perform comprehensive phylogenetic analysis of metal transporters across extremophiles from diverse environments

    • Identify convergent evolution patterns in unrelated extremophilic lineages

    • Map the acquisition of thermostability-conferring mutations along evolutionary timelines

    • Research questions to address:

      • Do metal transporters evolve faster or slower than other proteins in extremophiles?

      • Are there universal adaptive patterns across different types of extremophiles?

      • What is the relative contribution of horizontal gene transfer versus vertical evolution?

  • Structure-Function Analysis Across Temperature Gradients:

    Temperature AdaptationStructural FeaturesFunctional Implications
    Psychrophilic (<20°C)Enhanced flexibility, reduced hydrophobic packingLower stability, higher activity at low temperatures
    Mesophilic (20-45°C)Balanced rigidity and flexibilityOptimal function at moderate temperatures
    Thermophilic (45-80°C)Increased rigidity, extensive ion pairsMaintained function at elevated temperatures
    Hyperthermophilic (>80°C)Maximum rigidity, extensive disulfide bondsExtreme thermostability with potential activity tradeoffs

    Systematic comparison across this spectrum, using T. oceani CbiM (thermophilic) and its homologs, can reveal the molecular basis of temperature adaptation in metal transporters.

  • Molecular Evolution Experiments:

    • Laboratory evolution of mesophilic CbiM homologs under thermophilic conditions

    • Ancestral sequence reconstruction and resurrection of evolutionary intermediates

    • Directed evolution to identify minimal mutations required for thermostability

    • Potential outcomes:

      • Map evolutionary trajectories to thermostability

      • Identify epistatic interactions in adaptation

      • Determine if there are multiple adaptive pathways to thermostability

  • Functional Genomics in Extreme Environments:

    • Study metal transporter expression and regulation in extremophiles under natural conditions

    • Investigate how metal availability in extreme environments shapes transporter evolution

    • Examine co-evolution of metal transporters with metal-dependent cellular processes

    • Integration with ecological data to understand:

      • How does metal availability in deep-sea thermal vents influence transporter evolution?

      • Are there metal-specific adaptations in different extreme environments?

      • What is the relationship between environmental metal fluctuations and transporter regulation?

  • Structural Biology of Extremophilic Adaptations:

    • Determine high-resolution structures of metal transporters from organisms across temperature gradients

    • Map temperature-dependent conformational landscapes using advanced biophysical techniques

    • Identify structure-stability-function relationships specific to extremophiles

    • Research questions to pursue:

      • How do extremophilic transporters balance stability with the conformational changes needed for function?

      • Are there specialized structural elements that evolved specifically for function in extreme conditions?

      • How do membrane properties in extremophiles affect transporter structure and function?

  • Systems Biology of Metal Homeostasis in Extremophiles:

    • Comprehensive mapping of metal transport and utilization networks in extremophiles

    • Comparative analysis with mesophilic counterparts

    • Investigation of how entire metalloprotein networks adapt to extreme conditions

    • Potential insights:

      • Identification of unique regulatory mechanisms in extremophiles

      • Understanding of system-level adaptations to metal availability under extreme conditions

      • Discovery of novel metabolic dependencies on specific metals in extremophiles

These research directions, particularly when pursued in parallel, promise to provide fundamental insights into how metal transporters like T. oceani CbiM have evolved to function under extreme conditions. This knowledge has both basic scientific importance and potential biotechnological applications in developing robust biological systems for challenging environments.

How might new structural biology techniques advance our understanding of thermophilic membrane transporters like T. oceani CbiM?

Recent and emerging advances in structural biology offer unprecedented opportunities to understand thermophilic membrane transporters like T. oceani CbiM. These innovative techniques can provide insights that were previously inaccessible, particularly for challenging membrane proteins from extremophiles:

  • Cryo-Electron Microscopy (Cryo-EM) Advancements:

    • Single Particle Analysis at Near-Atomic Resolution:

      • Can now resolve membrane proteins <150 kDa without crystallization

      • Capable of capturing multiple conformational states in a single dataset

      • Allows visualization of T. oceani CbiM in native-like lipid environments

    • Tomography with Subtomogram Averaging:

      • Potential to study CbiM directly in native membranes or artificial liposomes

      • Can reveal organizational context and interactions with other components

      • Particularly valuable for understanding complete transport complexes

    • Time-Resolved Cryo-EM:

      • Emerging techniques for millisecond-scale mixing before vitrification

      • Could capture transient conformational states during transport cycle

      • Implementation strategy: mixing with cobalt followed by time-controlled vitrification

  • Integrative Structural Biology Approaches:

    Technique CombinationApplication to T. oceani CbiMExpected Outcomes
    Cryo-EM + Molecular DynamicsStructure determination followed by simulation at elevated temperaturesComplete conformational landscape at physiological temperatures
    XL-MS + Homology ModelingCross-linking constraints to guide model buildingReliable structures even with limited resolution data
    HDX-MS + Cryo-EMDynamic information to interpret static structuresCorrelation between flexibility and function
    DEER/PELDOR + Structural ModelsDistance constraints from strategic spin-labelsValidation of conformational changes during transport
  • Native Mass Spectrometry for Membrane Proteins:

    • Recent advances allow analysis of intact membrane protein complexes

    • Can determine:

      • Stoichiometry of complete transport complexes

      • Binding of cobalt and other ligands

      • Stability of complexes at different temperatures

      • Lipid interactions that may be critical for thermostability

    • Particular value for understanding how T. oceani CbiM interacts with other components of the cobalt transport machinery

  • Advanced Solid-State NMR Methods:

    • Dynamic Nuclear Polarization (DNP) enhancing sensitivity

    • Proton-detected fast magic-angle spinning techniques

    • Capable of determining:

      • Local structure around cobalt binding site

      • Dynamics of key residues during transport

      • Changes in protein-lipid interactions at different temperatures

    • Implementation challenges: requires isotope labeling and significant sample amounts

  • In-Cell Structural Biology:

    • Emerging capabilities to study structures in cellular environments

    • Cellular cryo-electron tomography to visualize transporters in native context

    • In-cell NMR to probe dynamics and interactions

    • Potential to understand how thermophilic cellular environment contributes to CbiM function

  • Serial Femtosecond Crystallography with XFELs:

    • Room-temperature or high-temperature structure determination

    • Potential for time-resolved studies at physiologically relevant temperatures

    • Minimal radiation damage allowing capture of native states

    • Particular value for visualizing metal coordination in the native state

  • Microfluidic-Enabled Structural Studies:

    • Precise control of temperature and solution conditions

    • Potential for in situ structure determination under thermophilic conditions

    • Real-time monitoring of structural changes during cobalt binding and transport

    • Implementation: specialized high-temperature microfluidic platforms coupled with real-time structural methods

These advanced techniques, particularly when used in combination, have the potential to transform our understanding of how thermophilic membrane transporters like T. oceani CbiM function at the molecular level. The insights gained could reveal not only the structural basis of thermostability but also the dynamic processes that allow these proteins to maintain function under extreme conditions. Such knowledge has fundamental importance for protein engineering and for developing biotechnological applications that leverage the unique properties of thermostable membrane transporters .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.