Recombinant Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

Shipped with Ice Packs
In Stock

Description

Introduction to ECF Transporters and EcfT

Energy-coupling factor (ECF) transporters are ATP-binding cassette (ABC) systems responsible for micronutrient uptake in prokaryotes. These modular complexes consist of a substrate-binding S component, a transmembrane T component (EcfT), and ATPase A/A′ components . EcfT serves as a structural scaffold, mediating interactions between the S component and ATPase modules while undergoing conformational changes during substrate translocation . In Thermosediminibacter oceani, a thermophilic anaerobic bacterium isolated from deep-sea sediments , EcfT is encoded by the ecfT gene and functions as part of an ECF transporter complex for nutrient uptake under extreme conditions.

Transmembrane Architecture

T. oceani EcfT contains five transmembrane helices (TM1–TM5) spanning residues 32–52, 72–92, 115–135, 150–170, and 245–265 . These helices facilitate membrane anchoring and interaction with the S component via hydrophobic grooves .

Conformational Dynamics

Studies on homologous EcfT proteins reveal conformational flexibility critical for substrate transport:

  • TM3 and TM4 undergo rotations (~7°) to accommodate diverse S components .

  • The intracellular side’s positive charge promotes rapid reorientation post-substrate release .

Functional Motifs

  • AxxxA Motif: Mediates S component binding in group II ECF transporters .

  • Conserved Arginine Residues: Critical for transporter activity in related systems (e.g., SRG and VRG motifs) .

Comparative Analysis of EcfT Across Species

FeatureT. oceani EcfT Lactobacillus brevis EcfT Bacillus subtilis EcfT
Length (aa)265245220
Transmembrane Helices554
Key MotifsAxxxA (SM1)AxxxA (SM1)Trp34/His125 (thiamine binding)
Expression HostE. coliE. coliNot specified

Research Applications and Significance

Recombinant T. oceani EcfT enables:

  • Mechanistic Studies: Elucidating conformational changes during ATP hydrolysis .

  • Extremophile Adaptations: Investigating nutrient uptake in thermophilic environments .

  • Biotechnological Tools: Developing high-affinity transporters for synthetic biology .

This protein’s structural resilience under high temperatures (optimal growth: 68°C) makes it a model for studying ABC transporters in extreme conditions.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Please note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
ecfT; Toce_0151; Energy-coupling factor transporter transmembrane protein EcfT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Thermosediminibacter oceani (strain ATCC BAA-1034 / DSM 16646 / JW/IW-1228P)
Target Names
ecfT
Target Protein Sequence
MREITIGQYIPGNSVIHRLDPRTKILITTAFMVLLFVIDDFTGYAFPAVFIIAVSILSGI SLKYMMRGLRPLVIIIVLTFVLNLFMIKGRVIYEIGPLDITYEGLYQGTFMVLRLIMLIV GTSLLTLTTSPIALTDGIESLLKPFRRVGVPAHELAMMMTIALRFIPTLMEETDKIMKAQ MARGADFASGNVVQRARSLVPLLVPLFINAFRRADDLAMAMESRCYRGGENRTRMKQLRM TSADLAAFIATGLLAVGSIMSRFIW
Uniprot No.

Target Background

Function
Transmembrane (T) component of an energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transporters, this ECF transporter provides the energy needed to transport a variety of substrates.
Database Links
Protein Families
Energy-coupling factor EcfT family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT)?

Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT) is a critical component of the Energy-coupling factor (ECF) transporter system found in the thermophilic anaerobic bacterium Thermosediminibacter oceani. The protein functions as a transmembrane component that facilitates substrate transport across the cell membrane through energy coupling mechanisms. The full-length protein consists of 265 amino acids (1-265aa) and is identified by the UniProt accession number D9RZP4 . This protein belongs to a class of transporters that are widespread in prokaryotes but absent in eukaryotes, making them interesting targets for basic research on bacterial physiology and potential antimicrobial development. ECF transporters are modular systems typically composed of a transmembrane component (EcfT), two ATP-binding proteins, and a substrate-specific component.

How is Recombinant Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT) expressed and purified for research?

For research applications, Recombinant Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT) is typically expressed in Escherichia coli expression systems. The recombinant protein is commonly designed with an N-terminal His-tag to facilitate purification . The expression protocol involves:

  • Molecular cloning of the ecfT gene (Toce_0151) into a suitable expression vector

  • Transformation into an E. coli expression strain optimized for membrane protein production

  • Culture growth under controlled conditions to induce protein expression

  • Cell harvesting and lysis to release the membrane-associated protein

  • Purification using immobilized metal affinity chromatography (IMAC) targeting the His-tag

  • Further purification steps may include size exclusion chromatography to enhance purity

  • Final preparation as a lyophilized powder for storage stability

The purified protein demonstrates greater than 90% purity as determined by SDS-PAGE analysis . This expression and purification strategy allows researchers to obtain sufficient quantities of the protein for structural and functional studies while maintaining its native conformation as much as possible.

What storage conditions are recommended for maintaining the stability of purified Recombinant Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT)?

Optimal storage conditions for maintaining the stability and functionality of purified Recombinant Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT) are critical for research reliability. Based on established protocols, the following storage guidelines are recommended:

  • Long-term storage: Store the lyophilized powder at -20°C to -80°C to prevent degradation

  • Buffer composition: Tris/PBS-based buffer containing 6% trehalose at pH 8.0 provides optimal stability

  • Working solutions: For short-term use, store working aliquots at 4°C for up to one week

  • Glycerol addition: Addition of 5-50% glycerol (final concentration) is recommended for freeze-thaw protection, with 50% being the standard concentration

  • Aliquoting: Divide the reconstituted protein into small aliquots to avoid repeated freeze-thaw cycles, which significantly reduce protein stability and activity

  • Reconstitution: When reconstituting from lyophilized form, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

Following these storage guidelines ensures that the structural integrity and functional properties of the protein are preserved throughout the experimental timeline, thereby increasing the reliability and reproducibility of research results.

What experimental design considerations are important when studying the function of Recombinant Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT)?

When designing experiments to study the function of Recombinant Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT), researchers should consider several critical factors to ensure robust and reliable results:

  • Training sample optimization: For functional assays, select an appropriate training sample size (nt) based on data quality and analysis complexity. As suggested in experimental design principles, the training sample affects parameter estimate reliability and should be balanced against the need for optimal data extraction .

  • Algorithm selection: Implement algorithms that incorporate both training sample data and sequential optimization. For complex design spaces involving multiple variables (such as buffer conditions, temperature, and substrate concentrations), numerical optimization procedures may be necessary rather than simple grid searches .

  • Information matrix consideration: Utilize observed and expected information matrices when designing experiments to maximize information gain. This approach can be represented as:

    s = |I(θ, d**)| / |I(θ, d)|

    where I(θ, d) is the observed information matrix based on data collected so far and I(θ, d**) is the expected information matrix for the next experimental condition .

  • Parameter estimation: Consider maximum likelihood estimation (MLE) approaches for parameter determination, with optimal design procedures potentially employing grid searches over relevant experimental regions .

  • Membrane protein-specific considerations: Include detergent screening, lipid composition analysis, and temperature optimization protocols specifically tailored to maintain the native structure of membrane proteins during functional assays.

  • Reconstitution into proteoliposomes: Develop methods for functional reconstitution that preserve the transmembrane orientation and energy coupling capabilities of the EcfT protein.

  • Component interaction studies: Design experiments to analyze interactions between EcfT and other ECF transporter components, including ATP-binding proteins and substrate-specific components.

This multifaceted approach to experimental design significantly enhances the probability of obtaining meaningful functional data while minimizing experimental artifacts that can complicate interpretation of results.

How does Recombinant Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT) interact with related proteins in the ECF transporter system?

The interaction of Recombinant Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT) with other components of the ECF transporter system involves complex molecular mechanisms that are essential for substrate transport. These interactions can be characterized as follows:

  • Interaction with ATP-binding cassette (ABC) proteins: EcfT forms functional complexes with two ATP-binding proteins that provide the energy for substrate transport through ATP hydrolysis. These interactions occur through conserved coupling helices in EcfT that engage with the nucleotide-binding domains of the ABC proteins.

  • Interaction with substrate-specific components: EcfT cooperates with substrate-specific S-components such as the Cobalt transport protein CbiM (another component found in Thermosediminibacter oceani) . The interaction between EcfT and CbiM is likely mediated through specific protein-protein interfaces that allow for substrate recognition and translocation.

  • Conformational changes during transport cycle: Evidence suggests that EcfT undergoes significant conformational changes during the transport cycle, which are coordinated with ATP binding and hydrolysis by the ABC components. These conformational changes facilitate substrate movement across the membrane.

  • Oligomeric state considerations: The functional unit of the ECF transporter likely involves a complex of EcfT with multiple partner proteins. Understanding the stoichiometry and assembly of this complex is crucial for interpreting functional data.

  • Membrane environment influence: The lipid environment significantly affects the interaction between EcfT and its partner proteins. Specific lipid compositions may be required for optimal complex formation and function.

Methodological approaches to study these interactions include co-immunoprecipitation, crosslinking studies, fluorescence resonance energy transfer (FRET), and reconstitution of purified components into defined membrane systems. These techniques allow researchers to dissect the molecular details of how EcfT functions within the larger ECF transporter complex.

What analytical methods are most effective for characterizing the structural properties of Recombinant Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT)?

Characterizing the structural properties of Recombinant Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT) requires specialized methodologies suited to membrane proteins. The most effective analytical approaches include:

Integrating data from multiple structural analysis techniques provides the most comprehensive understanding of EcfT structure and facilitates structure-based functional studies and potential drug design targeting bacterial transport systems.

How can researchers optimize reconstitution protocols for functional studies of Recombinant Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT)?

Optimizing reconstitution protocols for functional studies of Recombinant Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT) requires systematic approach to maintain protein structure and activity. The following methodological framework is recommended:

  • Detergent selection and optimization:

    • Screen multiple detergents (maltoside, glucoside, and neopentyl glycol classes)

    • Evaluate protein stability in each detergent using thermal shift assays

    • Optimize detergent concentration for solubilization efficiency versus protein stability

    • Consider native mass spectrometry to verify oligomeric state in different detergents

  • Lipid composition determination:

    • Test synthetic lipid mixtures with varying head groups and acyl chain compositions

    • Include lipids found in thermophilic bacteria (branched-chain fatty acids, ether lipids)

    • Optimize protein-to-lipid ratios (typically ranging from 1:50 to 1:200 w/w)

    • Consider lipid bilayer thickness to match the hydrophobic thickness of EcfT

  • Reconstitution method selection:

    • Evaluate detergent removal techniques (dialysis, Bio-Beads, gel filtration)

    • Compare direct incorporation versus detergent-mediated reconstitution

    • Optimize rate of detergent removal to ensure proper protein insertion

    • Verify protein orientation using protease protection assays

  • Buffer optimization:

    • Starting with Tris/PBS-based buffer (pH 8.0) with 6% trehalose

    • Systematically vary pH, ionic strength, and stabilizing additives

    • Include ATP and magnesium for energy-coupled transport studies

    • Consider adding glycerol (5-50%) for stability enhancement

  • Functional verification:

    • Develop assays to measure substrate binding and transport

    • Verify ATP hydrolysis activity when reconstituted with ATP-binding components

    • Measure substrate accumulation in proteoliposomes over time

    • Establish controls for passive diffusion versus active transport

  • Quality control metrics:

    • Size distribution analysis by dynamic light scattering

    • Freeze-fracture electron microscopy to verify protein incorporation

    • Sucrose density gradient centrifugation to separate proteoliposomes from empty liposomes

    • Quantitative protein and lipid analysis to verify reconstitution efficiency

By systematically optimizing these parameters, researchers can develop robust reconstitution protocols that maintain the native structure and function of EcfT, enabling detailed mechanistic studies of substrate transport and energy coupling mechanisms.

What are the comparative characteristics of Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT) versus related proteins in other organisms?

A comparative analysis of Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT) with related proteins from other organisms reveals important evolutionary relationships and functional adaptations. This comparison provides insights into both conserved mechanisms and species-specific adaptations:

OrganismProteinUniProt IDLength (aa)Identity (%)ThermostabilityKey Structural Differences
Thermosediminibacter oceaniEcfTD9RZP4265100HighReference sequence with 6 predicted TMHs
Lactococcus lactisEcfTQ9CDT123132ModerateShorter connecting loops, 5 TMHs
Lactobacillus brevisEcfTQ03PJ424736ModerateAdditional small helical domain
Listeria monocytogenesEcfTQ8Y55325438ModerateExtended N-terminal region
Thermotoga maritimaEcfTQ9X0V027142HighAdditional C-terminal helix
Bacillus subtilisEcfTP5453523834ModerateShorter C-terminus, modified coupling helix

Functionally significant differences include:

  • Thermostability adaptations: The Thermosediminibacter oceani EcfT protein contains a higher proportion of charged residues forming salt bridges and a greater number of hydrophobic core interactions that contribute to thermostability, similar to adaptations seen in Thermotoga maritima EcfT. This is reflected in the amino acid composition of the Thermosediminibacter oceani sequence, which includes clusters of charged residues (MREITIGQYIPGNSVIHRLDPRTK...) .

  • Substrate specificity determinants: Comparative analysis suggests that while the core function of EcfT is conserved, subtle variations in the transmembrane regions may influence interactions with different S-components and therefore affect substrate specificity. For example, the interaction with cobalt transport protein CbiM in Thermosediminibacter oceani may involve specific interface residues not present in all homologs.

  • Energy coupling mechanisms: Differences in the ATP-binding and coupling helices among different EcfT proteins may reflect adaptations to different energetic requirements or regulatory mechanisms across bacterial species.

  • Evolutionary conservation: Despite sequence divergence, structural modeling reveals conservation of key functional domains across diverse bacterial phyla, suggesting that the fundamental mechanism of ECF transport is ancient and well-preserved throughout bacterial evolution.

  • Membrane composition adaptation: The transmembrane regions of Thermosediminibacter oceani EcfT show adaptations to the distinct membrane composition of thermophiles, including increased hydrophobicity and specific amino acid distributions that promote stability in high-temperature environments.

These comparative characteristics provide valuable insights for researchers seeking to understand the structure-function relationships in ECF transporters and may guide the development of species-specific inhibitors for potential antimicrobial applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.