Recombinant Thermosipho africanus Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
crcB; THA_413; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Thermosipho africanus (strain TCF52B)
Target Names
crcB
Target Protein Sequence
MKSLYVAFGGALGAVSRYVISKFINSSFSFSFVPWGTIFVNVVGSFLLSFLMFLSISKTD ISQSFILFFGTGFLGAFTTFSTFAYEFLSIFLTQPLRAIIYFIANIFLGFFAAILGMFLG RGRIL
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration and its associated toxicity.
Database Links

KEGG: taf:THA_413

STRING: 484019.THA_413

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Thermosipho africanus and its genomic characteristics?

Thermosipho africanus is a thermophilic, anaerobic bacterium belonging to the order Thermotogales. The TCF52B strain was isolated from high-temperature oil reservoir fluids in the North Sea using fish waste as the only substrate. Its genome consists of a single circular chromosome of 2,016,657 bp with an average G+C content of 30.8%. The genome contains 1,913 protein-coding open reading frames (ORFs), 30 pseudogenes, and 57 RNA-encoding genes. The genome shows pronounced strand asymmetries with two clear singularity points that likely represent the origin and termination of replication .

How does Thermosipho africanus compare to other Thermosipho species?

Thermosipho africanus shares high 16S rRNA sequence similarity with other Thermosipho species but has distinct physiological characteristics. For example, T. melanesiensis shows 98.6% 16S rRNA sequence similarity with T. africanus but only 2% DNA-DNA reassociation, supporting its classification as a separate species . Similarly, T. atlanticus was identified as a novel species within the Thermosipho genus based on 16S rRNA gene sequence comparisons and distinctive physiological and biochemical characteristics . T. africanus TCF52B contains significantly more transposase or integrase-coding ORFs (78) compared to Thermotoga maritima (12), indicating greater genomic mobility .

What is the CrcB homolog protein and what is its general function?

The CrcB homolog protein in bacteria typically functions as a fluoride ion channel or transporter involved in fluoride resistance. These proteins help protect cells from the toxic effects of environmental fluoride by exporting fluoride ions from the cytoplasm. In thermophilic organisms like Thermosipho africanus, studying CrcB homologs is particularly interesting as they may exhibit enhanced thermal stability and potentially unique structural features adapted to extreme environments.

What approaches are most effective for expressing recombinant T. africanus CrcB homolog protein?

For successful expression of recombinant T. africanus CrcB homolog, consider using E. coli strains optimized for thermophilic proteins such as BL21(DE3) Rosetta or ArcticExpress. The expression should be conducted at lower temperatures (15-25°C) despite T. africanus being thermophilic, as this often improves folding of recombinant proteins. Using a codon-optimized sequence is crucial due to the significant difference in G+C content (30.8% for T. africanus versus ~50% for E. coli) . For membrane proteins like CrcB, consider fusion tags that enhance solubility (MBP, SUMO) or facilitate purification (His6, Strep-tag). Expression vectors with tightly controlled inducible promoters (T7/lac) are recommended to minimize toxicity.

How might lateral gene transfer events have influenced the evolution of the CrcB homolog in T. africanus?

Lateral gene transfer (LGT) has been a major force shaping the Thermosipho africanus TCF52B genome. Phylogenetic analysis reveals that 26% of phylogenetic trees suggest LGT with Firmicutes, while 13% of ORFs indicate LGT with Archaea . For the CrcB homolog, comparative genomic analysis of T. africanus with other Thermotogales and distantly related thermophiles would reveal whether this gene was acquired through LGT. The analysis should include generating maximum-likelihood phylogenetic trees using the PhyloGenie package to determine if the CrcB protein clusters with homologs from its taxonomic group or shows unexpected relationships with distantly related organisms, particularly Firmicutes or Archaea, which are the major LGT partners for T. africanus .

What structural adaptations might allow the CrcB homolog to function at the high temperatures T. africanus inhabits?

The CrcB homolog from T. africanus likely exhibits several thermostability-enhancing features: increased hydrophobic core packing, additional salt bridges and hydrogen bonding networks, reduced surface loop regions, higher proportion of charged amino acids (particularly Arg and Glu), and decreased thermolabile residues (Asn, Gln, Cys). Comparative structural analysis with mesophilic CrcB homologs would reveal specific adaptations. For experimental verification, thermal denaturation studies using differential scanning calorimetry (DSC) or circular dichroism (CD) spectroscopy should be conducted across a range of temperatures (60-90°C), considering T. africanus grows optimally at 70°C like its relative T. melanesiensis .

What are the optimal conditions for purifying functional T. africanus CrcB homolog protein?

The purification protocol for T. africanus CrcB homolog should account for its thermophilic origin and membrane protein nature. The optimal procedure includes:

  • Cell lysis in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and appropriate detergent (0.5-1% n-dodecyl-β-D-maltoside or CHAPS)

  • Heat treatment (65-70°C for 15-20 minutes) to leverage the thermostability of the target protein and eliminate many E. coli contaminants

  • Immobilized metal affinity chromatography if using His-tagged constructs

  • Size exclusion chromatography for further purification and detergent exchange

  • Buffer optimization with 30 g/L NaCl to match T. africanus optimal salinity
    Verification of protein folding should be conducted at 65°C, the optimal growth temperature for T. africanus relatives .

What are the most informative assays for characterizing CrcB homolog function?

Assay TypeMethodologyParameters MeasuredBenefits
Fluoride EffluxFluoride ion-selective electrode measurementsTransport rate, Km, VmaxDirect measurement of primary function
Fluoride ResistanceGrowth assays with varying F- concentrationsIC50, growth inhibitionPhysiological relevance
Patch-ClampElectrophysiology in reconstituted liposomesChannel conductance, ion selectivityDetailed kinetic parameters
Thermal StabilityDifferential scanning fluorimetry (DSF)Melting temperature (Tm)Temperature-dependent stability
Protein-Lipid InteractionSurface plasmon resonanceBinding affinities to various lipidsMembrane integration insights
For thermophilic proteins like T. africanus CrcB, all assays should be performed across a temperature range of 30-80°C to determine temperature optima for activity, with special attention to the 65-70°C range which represents the organism's optimal growth temperature .

How can researchers assess the impact of specific mutations on the T. africanus CrcB homolog?

To evaluate mutations in the T. africanus CrcB homolog, implement a systematic site-directed mutagenesis approach focusing on:

  • Conserved residues identified through multiple sequence alignment with CrcB homologs from other thermophiles and mesophiles

  • Residues unique to thermophilic CrcB variants

  • Predicted pore-lining residues based on structural models
    Each mutant should be assessed for:

  • Thermal stability using DSF or CD spectroscopy

  • Fluoride transport efficiency using ion-selective electrodes

  • Expression levels and membrane localization using Western blotting and fluorescence microscopy

  • Structural integrity using limited proteolysis
    Compare mutant phenotypes at both mesophilic (37°C) and thermophilic (65-70°C) temperatures to distinguish between effects on general function versus thermostability.

How does the T. africanus CrcB homolog compare to CrcB proteins from other thermophilic bacteria?

The CrcB homolog from T. africanus likely shares core functional domains with other thermophilic CrcB proteins while exhibiting species-specific adaptations. Comparative analysis should examine:

  • Sequence conservation patterns among thermophiles (e.g., Thermotoga maritima, Thermosipho melanesiensis) versus mesophiles

  • G+C content differences in the crcB gene compared to the genome average (30.8% for T. africanus)

  • Codon usage bias patterns that might indicate recent lateral gene transfer

  • Phylogenetic positioning relative to CrcB from the 78 transposase/integrase-rich regions in T. africanus
    Expected findings include higher conservation of functional residues across thermophiles despite diverse evolutionary origins, and potential evidence of convergent evolution in thermoadaptation mechanisms.

What insights can comparative genomics provide about the evolutionary history of the CrcB homolog in Thermosipho species?

Comparative genomic analysis of the CrcB homolog across Thermosipho species would reveal its evolutionary trajectory. Analysis should include:

  • Synteny mapping of the crcB genomic region across Thermosipho africanus, T. melanesiensis, and T. atlanticus

  • Identification of flanking mobile genetic elements, particularly among the 78 transposase/integrase ORFs in T. africanus

  • Analysis of crcB presence in the 12 CRISPR loci identified in T. africanus, which may indicate historical phage-mediated transfer

  • Calculation of dN/dS ratios to identify selection pressures
    The high prevalence of lateral gene transfer in T. africanus (26% of genes show evidence of LGT with Firmicutes, 13% with Archaea) suggests the CrcB homolog may have complex evolutionary origins that could be revealed through these analyses.

What are promising approaches for studying the in vivo function of the CrcB homolog in T. africanus?

Studying in vivo function of the CrcB homolog in T. africanus presents challenges due to limited genetic tools for thermophiles. Promising approaches include:

  • Heterologous expression in genetically tractable thermophiles like Thermus thermophilus

  • Development of CRISPR-Cas9 systems adapted for extreme thermophiles

  • Fluoride sensitivity assays in growth media with varying fluoride concentrations

  • Fluorescently-tagged CrcB expression to visualize membrane localization under different stress conditions

  • Transcriptomic and proteomic analysis of T. africanus under fluoride stress
    These approaches would benefit from the growing toolkit for genetic manipulation of extremophiles, while accounting for T. africanus-specific cultivation requirements (anaerobic conditions, 65°C optimal temperature, 30 g/L NaCl) .

How might structural studies of T. africanus CrcB homolog contribute to understanding fluoride channels across domains of life?

Structural studies of T. africanus CrcB would significantly advance understanding of fluoride channels by:

  • Providing insights into thermostable channel architecture that remains functional at 65-70°C

  • Revealing adaptation mechanisms that maintain ion selectivity under extreme conditions

  • Identifying structural features that could be engineered into mesophilic proteins for enhanced stability

  • Clarifying the evolutionary relationship between bacterial and archaeal fluoride channels
    X-ray crystallography or cryo-electron microscopy of the protein at different temperatures (37-80°C) would be particularly valuable. The thermostability of T. africanus CrcB may facilitate crystal formation, potentially overcoming challenges faced when crystallizing mesophilic membrane proteins.

What strategies can address protein aggregation issues when working with recombinant T. africanus CrcB homolog?

When encountering aggregation of recombinant T. africanus CrcB homolog, implement these strategies:

  • Optimize detergent selection by screening a panel (DDM, LMNG, CHAPS) at various concentrations (0.01-1%)

  • Incorporate lipids during purification (0.01-0.1 mg/mL of E. coli total lipid extract)

  • Add stabilizing agents (5-10% glycerol, 100-300 mM NaCl, 1-5 mM specific ions based on T. africanus native environment)

  • Test thermal pre-conditioning (gradual temperature increase from 30°C to 60°C during purification)

  • Engineer constructs with thermostable fusion partners (Thermus-derived proteins)
    Monitor aggregation quantitatively using dynamic light scattering at temperatures ranging from 25-70°C to identify the thermal threshold for aggregation onset.

How can researchers overcome expression challenges with the T. africanus CrcB homolog?

To overcome expression challenges:

  • Conduct codon optimization accounting for the low G+C content (30.8%) of T. africanus

  • Use specialized expression strains (C41/C43) designed for membrane proteins

  • Test induction conditions systematically:

    • Temperature: 15-30°C

    • Inducer concentration: 0.01-0.5 mM IPTG

    • Induction duration: 4-24 hours

  • Consider auto-induction media for gradual protein expression

  • Evaluate secretion-based systems that might reduce toxicity Expression levels should be verified using both whole-cell lysate analysis and membrane fraction isolation to distinguish between expression and membrane integration issues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.