Recombinant Thermosipho melanesiensis Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Introduction to Thermosipho melanesiensis

Thermosipho melanesiensis is a thermophilic, anaerobic bacterium belonging to the order Thermotogales. It was first isolated from the gills of a deep-sea vent hydrothermal mussel, Bathymodiolus brevior, from the Lau Basin in the Southwestern Pacific Ocean. This organism exhibits characteristics typical of members of the Thermotogales order, including the presence of a distinctive outer sheath-like structure called a "toga" .

The bacterium was identified as a member of the Thermosipho genus based on the presence of this toga structure, its 16S rRNA sequence, and its ability to metabolize various carbohydrates including sucrose, starch, glucose, maltose, lactose, cellobiose, and galactose. Morphologically, the cells are gram-negative and rod-shaped, typically occurring singly or in pairs, though occasionally forming chains of up to five cells .

Despite sharing a high percentage of 16S rRNA sequence similarity (98.6%) with Thermosipho africanus, T. melanesiensis is classified as a distinct species due to the weak level of DNA-DNA reassociation (only 2%) and distinct physiological characteristics .

Growth Conditions and Physiological Characteristics

T. melanesiensis thrives under extreme conditions that would be lethal to most organisms. Table 1 summarizes the optimal growth conditions for this extremophile.

Table 1: Optimal Growth Conditions for Thermosipho melanesiensis

ParameterOptimal Condition
Temperature70°C
pH6.5
Salinity30 g/L NaCl
Doubling Time100 minutes
Oxygen RequirementAnaerobic
Carbon SourcesSucrose, starch, glucose, maltose, lactose, cellobiose, galactose

These extreme growth conditions have significant implications for the enzymes produced by T. melanesiensis, including cobS, which would be expected to function optimally under similar conditions and exhibit remarkable thermostability .

Overview of Vitamin B12 Biosynthesis

Cobalamin (vitamin B12) is one of the most structurally complex cofactors found in nature, consisting of a corrin ring with a central cobalt ion and upper and lower axial ligands. The biosynthesis of this essential cofactor involves approximately 30 enzymatic steps and can occur through either aerobic or anaerobic pathways .

In bacterial systems, these pathways diverge at precorrin-2 and converge again at coby(II)rinic acid a,c-diamide. Eight peripheral methylation reactions occur during the biosynthesis, with identical temporal and spatial orders in both pathways .

Vitamin B12 Pathway in Thermosipho melanesiensis

One distinctive feature of the Thermosipho genus that has been studied at the genomic level is the presence of the complete vitamin B12 synthesis pathway. In Thermosipho species, the genes involved in vitamin B12 metabolism are organized into four distinct gene clusters :

  1. BtuFCD cluster: Involved in vitamin B12 transport

  2. Corriniod cluster: Involved in the synthesis of the corrin ring structure

  3. Cobalamin cluster: Contains genes for the assembly of the complete cobalamin molecule

  4. SucCoA cluster: Related to metabolic pathways utilizing vitamin B12 as a cofactor

These gene clusters can be regulated by B12 riboswitches, which are regulatory elements in the mRNA that bind directly to vitamin B12 and influence gene expression. The presence of these riboswitches in the Thermosipho genome indicates sophisticated regulation of B12 metabolism in response to environmental conditions and cellular requirements .

Gene and Protein Information

The cobS gene in T. melanesiensis is identified by the locus name Tmel_0857. Table 2 provides essential information about the cobS protein.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
cobS; Tmel_0857; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-232
Protein Length
full length protein
Species
Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Target Names
cobS
Target Protein Sequence
MIYDFLLSLGFISRIPINIKVKAFEVRVKRLPIYFPLVGYIPGILFFFGGSFENFLLKIL FLILGYYFFDLFHFDGFLDTLDGFLNQSSKEKRLEIMSKGDVGPFAVFFGTLYVVVFWTL YLEIPPITFIYSSVFGRYSMNLLMFFSKPAKKTGLGALFFPFQKKNLLFSSFFLLPLLFS MKYFFISYVVTVVFSYLMSIVSNSKIGGVTGDVLGGACLMTNGLLLVVLGVV
Uniprot No.

Target Background

Function
This enzyme catalyzes the formation of adenosylcobalamin (Ado-cobalamin) from adenosylcobinamide-GDP and α-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Cobalamin synthase (CobS) in Thermosipho melanesiensis?

Cobalamin synthase (CobS) in Thermosipho melanesiensis is a polytopic integral membrane protein that catalyzes the penultimate step in coenzyme B12 (adenosylcobalamin) biosynthesis. Specifically, CobS conducts the condensation reaction between activated corrin ring and lower ligand base intermediates, which represents a critical convergence point of two pathways necessary for nucleotide loop assembly . This enzyme is essential for the organism's ability to synthesize vitamin B12, which serves as a crucial cofactor for various metabolic reactions in extremophilic environments.

The CobS-catalyzed reaction specifically involves the condensation of adenosylcobinamide-GDP (AdoCbi-GDP) and α-ribazole phosphate (α-RP) to generate adenosylcobalamin 5' phosphate (AdoCbl-P) . This reaction is followed by a dephosphorylation step catalyzed by another enzyme (CobC) to yield the complete adenosylcobalamin molecule.

What genomic context surrounds the cobS gene in Thermosipho species?

In Thermosipho species, the genes involved in vitamin B12 metabolism are organized into four distinct gene clusters: BtuFCD, Corrinoid, Cobalamin, and SucCoA . These clusters are regulated by B12 riboswitches, RNA structural elements that modulate gene expression in response to B12 levels.

The cobS gene in Thermosipho melanesiensis is specifically identified by the locus name Tmel_0857 . Comparative genomic analyses have shown that while all Thermosipho species contain the genes required for cobalamin biosynthesis, there are species-specific variations in these pathway components that likely reflect adaptation to different extreme environments.

How does membrane integration affect CobS enzyme activity?

Membrane integration significantly enhances CobS enzyme activity. Studies on related CobS proteins have demonstrated that when reconstituted into liposomes, CobS exhibits substantially higher catalytic efficiency compared to the solubilized form. Specifically, research on Salmonella CobS showed that the specific activity of CobS embedded in liposomes was more than 20-fold higher (2.26 μmol AdoCbl-P min⁻¹ mg⁻¹) than that of detergent-solubilized CobS (0.11 μmol AdoCbl-P min⁻¹ mg⁻¹) .

This dramatic enhancement of activity when incorporated into a lipid bilayer suggests that the membrane environment plays a crucial role in maintaining the proper structural conformation of CobS for optimal catalytic function. The physiological relevance of membrane association for CobS function remains an important research question, as this association is conserved among all cobamide-producing organisms despite their diverse ecological niches .

What are the recommended methods for recombinant expression and purification of T. melanesiensis CobS?

For recombinant expression and purification of T. melanesiensis CobS, researchers should consider the following approach based on protocols developed for related CobS proteins:

  • Expression system selection: Due to the membrane-integrated nature of CobS, expression systems that handle membrane proteins efficiently should be selected. E. coli strains specialized for membrane protein expression (such as C41(DE3) or C43(DE3)) are recommended.

  • Affinity tag incorporation: Incorporate an affinity tag (typically His6) to facilitate purification. The tag placement should be carefully considered to minimize interference with protein folding and function.

  • Solubilization strategy: Properly solubilize the membrane-embedded CobS using phospholipid-based extraction rather than harsh detergents. Studies with Salmonella CobS showed that attempts to solubilize with detergents such as Nonidet P-40, Brij35, CHAPS, LDAO, and n-tetradecyl-N-N-dimethylglycine were unsuccessful .

  • Purification protocol: Implement a two-step purification protocol combining affinity chromatography with size exclusion chromatography to achieve high purity (≥95%).

  • Storage conditions: Store purified recombinant CobS in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage . Avoid repeated freeze-thaw cycles, and keep working aliquots at 4°C for up to one week.

How can T. melanesiensis CobS be reconstituted into liposomes for functional studies?

Reconstitution of T. melanesiensis CobS into liposomes is recommended for functional studies due to the significant enhancement of enzymatic activity in a lipid bilayer environment. The following protocol is suggested:

  • Liposome preparation: Prepare liposomes using a mixture of phospholipids that mimic the natural membrane environment of thermophilic bacteria. Typically, a mixture of phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin can be used.

  • Protein incorporation: Incorporate the purified CobS protein into preformed liposomes using a detergent-mediated reconstitution method. This typically involves mixing the solubilized protein with liposomes, followed by controlled detergent removal.

  • Detergent removal: Remove detergent gradually using either dialysis or adsorption to Bio-Beads.

  • Verification of incorporation: Confirm successful incorporation of CobS into the liposomes using techniques such as western blotting with anti-CobS antibodies and density gradient centrifugation .

  • Functionality assessment: Verify the functionality of reconstituted CobS using enzymatic assays that measure the formation of adenosylcobalamin 5' phosphate.

What assays are available for measuring T. melanesiensis CobS enzyme activity?

Several complementary assays can be employed to measure the enzymatic activity of T. melanesiensis CobS:

  • Continuous spectrophotometric assay: This assay monitors the condensation reaction catalyzed by CobS in real-time through spectrophotometric measurements. The reaction progress can be followed by measuring changes in absorbance associated with the conversion of substrates to products .

  • HPLC-based assay: Reverse-phase high-pressure liquid chromatography (HPLC) can be used to separate and quantify the reaction products, using authentic cobalamin 5'-P as a positive control .

  • Bioassay approach: A complementation bioassay using a Salmonella enterica ΔcobS strain can provide a biological readout of CobS activity. Growth of the CobS-deficient strain in an agar overlay is contingent upon the provision of functional CobS reaction products .

  • Radioisotope-based assays: Incorporation of radioisotope-labeled substrates (such as 14C- or 3H-labeled nucleotide precursors) allows for sensitive detection of product formation through scintillation counting.

How has CobS evolved within Thermosipho species adapted to different extreme environments?

The evolution of CobS within Thermosipho species reflects adaptation to diverse extreme environments. Thermosipho species inhabit various high-temperature habitats including marine hydrothermal vents, petroleum reservoirs, and terrestrial hot springs . Comparative genomic analyses have identified three distinct Thermosipho species with different habitat distributions: the widely distributed T. africanus and the more specialized T. melanesiensis and T. affectus .

These habitat specializations correlate with genomic differences, including variations in the genes involved in cobalamin biosynthesis. The differences in CobS and other cobalamin-related enzymes may reflect adaptations to specific ecological niches, with habitat generalists like T. africanus potentially exhibiting broader substrate specificity or tolerance to varying conditions.

The conservation of membrane association for CobS across phylogenetically diverse species suggests that this feature provides a significant evolutionary advantage, possibly related to substrate channeling, protein-protein interactions, or protection of reactive intermediates from the cellular environment .

What differences exist in cobalamin biosynthesis pathways between T. melanesiensis and other thermophilic bacteria?

Cobalamin biosynthesis pathways in thermophilic bacteria show variations that likely reflect adaptations to different extreme environments. In Thermosipho melanesiensis, the vitamin B12 metabolism genes are organized into four gene clusters (BtuFCD, Corrinoid, Cobalamin, and SucCoA) regulated by B12 riboswitches .

Thermosipho species appear to have undergone genome streamlining, which has influenced their metabolic capacities, including cobalamin biosynthesis . The presence of complete CRISPR-cas immune systems in T. melanesiensis, which limit horizontal gene transfer, may have contributed to the conservation of specific patterns in the cobalamin biosynthetic pathway compared to species with higher rates of genomic recombination .

While all Thermosipho species maintain the core components of the cobalamin biosynthesis pathway, differences in genome size and content between species correlate with metabolic potential. For instance, T. africanus has larger genomes and more carbohydrate metabolism genes, potentially enabling adaptation to more diverse habitats .

How can structural modeling inform mutagenesis studies of T. melanesiensis CobS?

Structural modeling of T. melanesiensis CobS can guide targeted mutagenesis studies to elucidate structure-function relationships. Researchers should consider:

  • Homology modeling: Generate a 3D structural model of T. melanesiensis CobS based on the known structures of related proteins or using predictive algorithms specialized for membrane proteins.

  • Identification of conserved motifs: Analyze the protein sequence to identify highly conserved residues across different species, which often indicate functionally critical regions.

  • Substrate binding pocket prediction: Predict the substrate binding pockets for both AdoCbi-GDP and α-ribazole phosphate through docking simulations.

  • Transmembrane topology analysis: Determine the membrane topology to identify loops and domains exposed to different cellular compartments.

  • Targeted mutagenesis strategy: Design mutations targeting:

    • Conserved residues in predicted catalytic sites

    • Residues at the membrane-cytoplasm interface

    • Residues potentially involved in substrate recognition

  • Functional validation: Assess the impact of mutations on enzyme activity using the assays described in section 3.3.

What factors influence the thermostability of T. melanesiensis CobS and how can this be investigated?

Investigating the thermostability of T. melanesiensis CobS is particularly relevant given its origin from a thermophilic organism. Several approaches can be employed:

  • Differential scanning calorimetry (DSC): Measure the thermal denaturation profile of purified CobS to determine its melting temperature (Tm) and the thermodynamic parameters associated with unfolding.

  • Activity assays at various temperatures: Assess enzyme activity across a temperature range (30-90°C) to determine the temperature optimum and stability profile.

  • Circular dichroism (CD) spectroscopy: Monitor changes in secondary structure elements as a function of temperature.

  • Comparative analysis with mesophilic homologs: Compare the amino acid composition and structural features of T. melanesiensis CobS with those of CobS from mesophilic organisms to identify potential thermostabilizing features.

  • Investigation of lipid membrane effects: Examine how different lipid compositions in reconstituted proteoliposomes affect the thermostability of CobS, particularly lipids characteristic of thermophilic bacterial membranes.

  • Site-directed mutagenesis: Introduce mutations that potentially alter thermostability based on comparative genomics insights, focusing on:

    • Charged residue networks

    • Proline content in loop regions

    • Hydrophobic core packing

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.